Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   CV726_RS00940 Genome accession   NZ_CP024950
Coordinates   199746..199859 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   Q9ZEL1
Organism   Helicobacter pylori strain B130A     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 194746..204859
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CV726_RS00915 (CV726_00920) - 194808..197033 (+) 2226 WP_145939923.1 ATP-dependent Clp protease ATP-binding subunit -
  CV726_RS00920 (CV726_00925) panD 197023..197376 (+) 354 WP_000142239.1 aspartate 1-decarboxylase -
  CV726_RS00925 (CV726_00930) - 197379..197672 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  CV726_RS00930 (CV726_00935) - 197672..198667 (+) 996 WP_145940748.1 PDZ domain-containing protein -
  CV726_RS00935 (CV726_00940) comB6 198675..199730 (+) 1056 WP_145939924.1 P-type conjugative transfer protein TrbL Machinery gene
  CV726_RS00940 (CV726_00945) comB7 199746..199859 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  CV726_RS00945 (CV726_00950) comB8 199856..200599 (+) 744 WP_145939925.1 virB8 family protein Machinery gene
  CV726_RS00950 (CV726_00955) comB9 200599..201588 (+) 990 WP_145939926.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  CV726_RS00955 (CV726_00960) comB10 201581..202711 (+) 1131 WP_001045759.1 DNA type IV secretion system protein ComB10 Machinery gene
  CV726_RS00960 (CV726_00965) - 202781..204193 (+) 1413 WP_145939927.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=215424 CV726_RS00940 WP_001217873.1 199746..199859(+) (comB7) [Helicobacter pylori strain B130A]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=215424 CV726_RS00940 WP_001217873.1 199746..199859(+) (comB7) [Helicobacter pylori strain B130A]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9ZEL1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment