Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   BVH55_RS02480 Genome accession   NZ_CP019040
Coordinates   423734..423853 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain GH1-13     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 418734..428853
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BVH55_RS02465 (BVH55_02480) - 420346..421029 (+) 684 WP_003156341.1 response regulator transcription factor -
  BVH55_RS02470 (BVH55_02485) - 421016..422449 (+) 1434 WP_172802825.1 HAMP domain-containing sensor histidine kinase -
  BVH55_RS02475 (BVH55_02490) rapC 422602..423750 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  BVH55_RS02480 (BVH55_02495) phrC 423734..423853 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  BVH55_RS02485 (BVH55_02500) - 424004..424099 (-) 96 WP_012116800.1 YjcZ family sporulation protein -
  BVH55_RS02490 (BVH55_02505) - 424194..425558 (-) 1365 WP_077721796.1 aspartate kinase -
  BVH55_RS02495 (BVH55_02510) ceuB 425973..426926 (+) 954 WP_003156332.1 ABC transporter permease Machinery gene
  BVH55_RS02500 (BVH55_02515) - 426916..427863 (+) 948 WP_077721797.1 iron chelate uptake ABC transporter family permease subunit -
  BVH55_RS02505 (BVH55_02520) - 427857..428615 (+) 759 WP_022552588.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=212724 BVH55_RS02480 WP_003156334.1 423734..423853(+) (phrC) [Bacillus velezensis strain GH1-13]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=212724 BVH55_RS02480 WP_003156334.1 423734..423853(+) (phrC) [Bacillus velezensis strain GH1-13]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment