Detailed information
Bioinformatically predicted
Overview
| Name | pilH | Type | Machinery gene |
| Locus tag | BVD88_RS08050 | Genome accession | NZ_CP018907 |
| Coordinates | 1351353..1352030 (-) | Length | 225 a.a. |
| NCBI ID | WP_061701871.1 | Uniprot ID | A0AB36RUI9 |
| Organism | Neisseria meningitidis strain M21273 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1293667..1359621 | 1351353..1352030 | within | 0 |
Gene organization within MGE regions
Location: 1293667..1359621
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BVD88_RS07650 (BVD88_07990) | - | 1293667..1295892 (+) | 2226 | WP_002220751.1 | NADP-dependent isocitrate dehydrogenase | - |
| BVD88_RS07660 | - | 1297060..1297194 (+) | 135 | Protein_1240 | IS110 family transposase | - |
| BVD88_RS07665 (BVD88_08010) | - | 1297279..1298253 (+) | 975 | WP_002220749.1 | IS5 family transposase | - |
| BVD88_RS07675 (BVD88_08020) | - | 1298600..1298824 (+) | 225 | WP_002234261.1 | AAA family ATPase | - |
| BVD88_RS13990 | - | 1298882..1298938 (+) | 57 | Protein_1243 | hypothetical protein | - |
| BVD88_RS07680 (BVD88_08025) | - | 1298951..1299244 (+) | 294 | WP_002214491.1 | hypothetical protein | - |
| BVD88_RS07685 (BVD88_08030) | - | 1299287..1299490 (+) | 204 | WP_002214489.1 | hypothetical protein | - |
| BVD88_RS07695 (BVD88_08045) | - | 1300511..1301674 (+) | 1164 | WP_002220748.1 | JmjC domain-containing protein | - |
| BVD88_RS07700 (BVD88_08050) | - | 1301681..1301887 (+) | 207 | WP_002220746.1 | hypothetical protein | - |
| BVD88_RS07705 (BVD88_08055) | - | 1301911..1302246 (+) | 336 | WP_002261717.1 | hypothetical protein | - |
| BVD88_RS07710 (BVD88_08060) | - | 1302281..1304386 (+) | 2106 | WP_024465089.1 | peptidase domain-containing ABC transporter | - |
| BVD88_RS07715 (BVD88_08065) | - | 1304388..1305650 (+) | 1263 | WP_002214479.1 | HlyD family secretion protein | - |
| BVD88_RS07720 (BVD88_08070) | - | 1305920..1306759 (-) | 840 | WP_002214477.1 | hypothetical protein | - |
| BVD88_RS07725 (BVD88_08075) | - | 1306800..1307807 (+) | 1008 | WP_002220741.1 | IS5 family transposase | - |
| BVD88_RS14175 (BVD88_08090) | - | 1308223..1308354 (+) | 132 | WP_002217434.1 | hypothetical protein | - |
| BVD88_RS07740 (BVD88_08095) | - | 1308351..1308719 (+) | 369 | WP_002220735.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
| BVD88_RS13720 | - | 1308735..1308905 (+) | 171 | WP_164728559.1 | hypothetical protein | - |
| BVD88_RS07745 (BVD88_08100) | - | 1309052..1309648 (+) | 597 | WP_228378133.1 | DUF4760 domain-containing protein | - |
| BVD88_RS07750 (BVD88_08105) | - | 1310007..1310243 (+) | 237 | WP_002217439.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| BVD88_RS07755 (BVD88_08110) | - | 1310245..1310592 (+) | 348 | WP_002217440.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| BVD88_RS07760 (BVD88_08115) | - | 1310645..1311154 (-) | 510 | WP_002220734.1 | hypothetical protein | - |
| BVD88_RS07765 (BVD88_08120) | - | 1311166..1311639 (-) | 474 | WP_002220733.1 | D-Ala-D-Ala carboxypeptidase family metallohydrolase | - |
| BVD88_RS07770 (BVD88_08125) | - | 1311778..1312053 (-) | 276 | WP_002217443.1 | hypothetical protein | - |
| BVD88_RS07775 (BVD88_08130) | - | 1312050..1312475 (-) | 426 | WP_002220721.1 | hypothetical protein | - |
| BVD88_RS07780 (BVD88_08135) | - | 1312539..1312910 (-) | 372 | WP_002220720.1 | hypothetical protein | - |
| BVD88_RS14255 (BVD88_08140) | - | 1312978..1313184 (-) | 207 | WP_002217448.1 | hypothetical protein | - |
| BVD88_RS07790 (BVD88_08145) | - | 1313201..1313647 (-) | 447 | WP_002220718.1 | hypothetical protein | - |
| BVD88_RS07795 (BVD88_08150) | gpJ | 1313718..1317983 (-) | 4266 | WP_002220717.1 | TipJ family phage tail tip protein | - |
| BVD88_RS07800 (BVD88_08155) | - | 1318119..1318841 (-) | 723 | WP_002220716.1 | tail assembly protein | - |
| BVD88_RS07805 (BVD88_08160) | - | 1318838..1319593 (-) | 756 | WP_002244525.1 | C40 family peptidase | - |
| BVD88_RS07810 (BVD88_08165) | - | 1319590..1320312 (-) | 723 | WP_002217456.1 | phage minor tail protein L | - |
| BVD88_RS07815 (BVD88_08170) | - | 1320372..1320641 (-) | 270 | WP_002217457.1 | phage tail protein | - |
| BVD88_RS07820 (BVD88_08175) | - | 1320663..1323881 (-) | 3219 | WP_002224445.1 | phage tail length tape measure family protein | - |
| BVD88_RS07825 (BVD88_08180) | - | 1323874..1324146 (-) | 273 | WP_002220710.1 | DUF1799 domain-containing protein | - |
| BVD88_RS07830 (BVD88_08185) | - | 1324194..1324505 (-) | 312 | WP_002220709.1 | phage tail assembly chaperone | - |
| BVD88_RS07835 (BVD88_08190) | - | 1324569..1325210 (-) | 642 | WP_002220708.1 | phage tail protein | - |
| BVD88_RS07840 (BVD88_08195) | - | 1325242..1325661 (-) | 420 | WP_002244524.1 | hypothetical protein | - |
| BVD88_RS07845 (BVD88_08200) | - | 1325642..1325944 (-) | 303 | WP_002244523.1 | head-tail joining protein | - |
| BVD88_RS07850 (BVD88_08205) | - | 1325937..1326164 (-) | 228 | WP_002220705.1 | hypothetical protein | - |
| BVD88_RS07855 (BVD88_08210) | - | 1326222..1328114 (-) | 1893 | WP_002220704.1 | phage major capsid protein | - |
| BVD88_RS07860 (BVD88_08215) | - | 1328095..1329657 (-) | 1563 | WP_002220703.1 | phage portal protein | - |
| BVD88_RS07865 (BVD88_08220) | - | 1329666..1329920 (-) | 255 | WP_002220702.1 | hypothetical protein | - |
| BVD88_RS07870 (BVD88_08225) | - | 1329907..1330293 (-) | 387 | WP_002220701.1 | DUF3310 domain-containing protein | - |
| BVD88_RS07875 (BVD88_08230) | - | 1330296..1330505 (-) | 210 | WP_002220700.1 | hypothetical protein | - |
| BVD88_RS07880 (BVD88_08235) | - | 1330522..1333368 (-) | 2847 | WP_002220699.1 | primase-helicase family protein | - |
| BVD88_RS07885 (BVD88_08240) | - | 1333483..1333830 (-) | 348 | WP_002220698.1 | hypothetical protein | - |
| BVD88_RS07895 (BVD88_08250) | - | 1334230..1334946 (+) | 717 | WP_002220696.1 | LexA family transcriptional regulator | - |
| BVD88_RS07900 (BVD88_08255) | - | 1335049..1335474 (+) | 426 | WP_002220695.1 | hypothetical protein | - |
| BVD88_RS07905 (BVD88_08260) | - | 1335705..1335905 (+) | 201 | WP_002219431.1 | hypothetical protein | - |
| BVD88_RS07910 (BVD88_08265) | - | 1335973..1336332 (+) | 360 | WP_002220694.1 | hypothetical protein | - |
| BVD88_RS07915 (BVD88_08270) | - | 1336357..1337211 (+) | 855 | WP_002220693.1 | YfdQ family protein | - |
| BVD88_RS07920 (BVD88_08275) | - | 1337283..1337498 (+) | 216 | WP_002220692.1 | hypothetical protein | - |
| BVD88_RS07925 (BVD88_08280) | - | 1337534..1337794 (+) | 261 | WP_002220690.1 | NGO1622 family putative holin | - |
| BVD88_RS07930 (BVD88_08285) | - | 1337791..1338084 (+) | 294 | WP_002220689.1 | hypothetical protein | - |
| BVD88_RS07935 (BVD88_08290) | - | 1338087..1338278 (+) | 192 | WP_002219435.1 | type ISP restriction/modification enzyme | - |
| BVD88_RS07940 (BVD88_08295) | - | 1338278..1338418 (+) | 141 | WP_002220688.1 | hypothetical protein | - |
| BVD88_RS07945 (BVD88_08300) | - | 1338415..1338624 (+) | 210 | WP_002220687.1 | hypothetical protein | - |
| BVD88_RS07950 (BVD88_08305) | - | 1338682..1339599 (-) | 918 | WP_002220686.1 | KilA-N domain-containing protein | - |
| BVD88_RS07955 (BVD88_08310) | - | 1340465..1340977 (-) | 513 | WP_002220685.1 | DUF4760 domain-containing protein | - |
| BVD88_RS07965 (BVD88_08320) | - | 1341380..1341760 (-) | 381 | WP_002220683.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| BVD88_RS07970 (BVD88_08325) | - | 1341915..1343111 (-) | 1197 | WP_002224447.1 | tyrosine-type recombinase/integrase | - |
| BVD88_RS07985 (BVD88_08340) | yaaA | 1343643..1344422 (-) | 780 | WP_002220681.1 | peroxide stress protein YaaA | - |
| BVD88_RS14395 | - | 1344471..1344596 (-) | 126 | Protein_1302 | IS5/IS1182 family transposase | - |
| BVD88_RS07995 (BVD88_08345) | dapC | 1344684..1345871 (-) | 1188 | WP_002220680.1 | succinyldiaminopimelate transaminase | - |
| BVD88_RS08000 (BVD88_08350) | dut | 1345947..1346399 (-) | 453 | WP_002220679.1 | dUTP diphosphatase | - |
| BVD88_RS08005 (BVD88_08355) | - | 1346542..1346970 (+) | 429 | Protein_1305 | AzlC family ABC transporter permease | - |
| BVD88_RS08030 (BVD88_08380) | pilX | 1348718..1349191 (-) | 474 | WP_002247808.1 | PilX family type IV pilin | Machinery gene |
| BVD88_RS08035 (BVD88_08385) | pilK | 1349196..1349795 (-) | 600 | WP_002220676.1 | pilus assembly PilX family protein | Machinery gene |
| BVD88_RS08040 (BVD88_08390) | pilJ | 1349774..1350712 (-) | 939 | WP_104916082.1 | PilW family protein | Machinery gene |
| BVD88_RS08045 (BVD88_08395) | pilV | 1350709..1351329 (-) | 621 | WP_061725124.1 | type IV pilus modification protein PilV | Machinery gene |
| BVD88_RS08050 (BVD88_08400) | pilH | 1351353..1352030 (-) | 678 | WP_061701871.1 | GspH/FimT family pseudopilin | Machinery gene |
| BVD88_RS08055 (BVD88_08410) | dnaB | 1352339..1353745 (-) | 1407 | WP_002213843.1 | replicative DNA helicase | - |
| BVD88_RS08065 (BVD88_08420) | - | 1353907..1354494 (+) | 588 | WP_002220670.1 | superoxide dismutase | - |
| BVD88_RS08075 (BVD88_08425) | - | 1355022..1355531 (-) | 510 | WP_002213852.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
| BVD88_RS08080 (BVD88_08430) | - | 1355862..1356194 (-) | 333 | WP_002213854.1 | hypothetical protein | - |
| BVD88_RS14400 | - | 1356239..1356346 (-) | 108 | Protein_1315 | IS5/IS1182 family transposase | - |
| BVD88_RS08085 (BVD88_08435) | cysT | 1356485..1357321 (+) | 837 | WP_002219451.1 | sulfate ABC transporter permease subunit CysT | - |
| BVD88_RS08095 (BVD88_08445) | cysW | 1357691..1358551 (+) | 861 | WP_002220668.1 | sulfate ABC transporter permease subunit CysW | - |
| BVD88_RS08100 (BVD88_08450) | - | 1358548..1359621 (+) | 1074 | WP_002229312.1 | sulfate/molybdate ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 225 a.a. Molecular weight: 25239.95 Da Isoelectric Point: 10.2309
>NTDB_id=211669 BVD88_RS08050 WP_061701871.1 1351353..1352030(-) (pilH) [Neisseria meningitidis strain M21273]
MCTRKQQGFTLTELLIVMVIAAIMAMIALPNMSQWIASRRIASHAERIANLLRFSRGEAVRLNLPVYICPVQVKKDGTPN
NKCDSGKKGQGMLAFGDKNGNKTYDGDTADVLLRSVVLNDDINNKRINYAFNHIAFGQTQPTADRVVWTFNQNGTFGYTK
DQHLTSKSSFFYSDGYIQIVLTDARAVSDADKKFRSAVVLINSSGRVEVCPRGDRRTRRTMCQYK
MCTRKQQGFTLTELLIVMVIAAIMAMIALPNMSQWIASRRIASHAERIANLLRFSRGEAVRLNLPVYICPVQVKKDGTPN
NKCDSGKKGQGMLAFGDKNGNKTYDGDTADVLLRSVVLNDDINNKRINYAFNHIAFGQTQPTADRVVWTFNQNGTFGYTK
DQHLTSKSSFFYSDGYIQIVLTDARAVSDADKKFRSAVVLINSSGRVEVCPRGDRRTRRTMCQYK
Nucleotide
Download Length: 678 bp
>NTDB_id=211669 BVD88_RS08050 WP_061701871.1 1351353..1352030(-) (pilH) [Neisseria meningitidis strain M21273]
ATGTGTACACGAAAACAACAAGGTTTCACGCTAACAGAGCTGCTCATCGTGATGGTCATTGCAGCCATTATGGCGATGAT
AGCCCTCCCCAATATGAGCCAATGGATTGCATCCCGCCGCATTGCCAGTCACGCGGAGCGGATTGCCAACCTTTTGCGTT
TCTCCAGGGGCGAAGCCGTCCGGCTCAATCTCCCTGTCTATATCTGTCCTGTTCAAGTTAAAAAAGACGGTACGCCCAAC
AATAAATGTGACTCCGGCAAGAAGGGGCAGGGAATGTTGGCTTTTGGCGATAAGAATGGCAATAAGACATATGACGGCGA
TACGGCGGATGTTCTTCTCCGCAGTGTGGTATTGAATGATGATATCAATAATAAGCGGATTAATTATGCCTTCAACCATA
TCGCTTTCGGTCAGACTCAGCCGACCGCTGACCGTGTAGTTTGGACATTCAATCAAAACGGGACGTTCGGTTATACGAAA
GACCAGCATCTTACAAGCAAATCCAGCTTTTTTTATTCCGACGGTTATATCCAAATCGTGCTGACAGATGCGAGAGCAGT
TTCAGATGCCGATAAGAAATTCCGTTCGGCGGTGGTTTTGATTAACAGCAGCGGCAGGGTCGAAGTTTGCCCTAGGGGTG
ATCGGCGTACTCGGCGTACTATGTGCCAGTATAAATAA
ATGTGTACACGAAAACAACAAGGTTTCACGCTAACAGAGCTGCTCATCGTGATGGTCATTGCAGCCATTATGGCGATGAT
AGCCCTCCCCAATATGAGCCAATGGATTGCATCCCGCCGCATTGCCAGTCACGCGGAGCGGATTGCCAACCTTTTGCGTT
TCTCCAGGGGCGAAGCCGTCCGGCTCAATCTCCCTGTCTATATCTGTCCTGTTCAAGTTAAAAAAGACGGTACGCCCAAC
AATAAATGTGACTCCGGCAAGAAGGGGCAGGGAATGTTGGCTTTTGGCGATAAGAATGGCAATAAGACATATGACGGCGA
TACGGCGGATGTTCTTCTCCGCAGTGTGGTATTGAATGATGATATCAATAATAAGCGGATTAATTATGCCTTCAACCATA
TCGCTTTCGGTCAGACTCAGCCGACCGCTGACCGTGTAGTTTGGACATTCAATCAAAACGGGACGTTCGGTTATACGAAA
GACCAGCATCTTACAAGCAAATCCAGCTTTTTTTATTCCGACGGTTATATCCAAATCGTGCTGACAGATGCGAGAGCAGT
TTCAGATGCCGATAAGAAATTCCGTTCGGCGGTGGTTTTGATTAACAGCAGCGGCAGGGTCGAAGTTTGCCCTAGGGGTG
ATCGGCGTACTCGGCGTACTATGTGCCAGTATAAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilH | Neisseria gonorrhoeae MS11 |
84.722 |
96 |
0.813 |