Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   BUN12_RS08025 Genome accession   NZ_CP018902
Coordinates   1549125..1549391 (-) Length   88 a.a.
NCBI ID   WP_044051905.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain HK1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1544125..1554391
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BUN12_RS07975 (BUN12_1577) sinR 1544291..1544626 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  BUN12_RS07980 (BUN12_1578) tasA 1544674..1545459 (-) 786 WP_013352862.1 biofilm matrix protein TasA -
  BUN12_RS07985 (BUN12_1579) sipW 1545524..1546108 (-) 585 WP_013352863.1 signal peptidase I SipW -
  BUN12_RS07990 (BUN12_1580) tapA 1546080..1546751 (-) 672 WP_013352864.1 amyloid fiber anchoring/assembly protein TapA -
  BUN12_RS07995 (BUN12_1581) - 1547009..1547338 (+) 330 WP_013352865.1 DUF3889 domain-containing protein -
  BUN12_RS08000 (BUN12_1582) - 1547379..1547558 (-) 180 WP_013352866.1 YqzE family protein -
  BUN12_RS08005 (BUN12_1583) comGG 1547612..1547989 (-) 378 WP_013352867.1 competence type IV pilus minor pilin ComGG Machinery gene
  BUN12_RS08010 comGF 1547991..1548491 (-) 501 WP_013352868.1 competence type IV pilus minor pilin ComGF -
  BUN12_RS08015 (BUN12_1585) comGE 1548400..1548714 (-) 315 WP_014470662.1 competence type IV pilus minor pilin ComGE Machinery gene
  BUN12_RS08020 (BUN12_1586) comGD 1548698..1549135 (-) 438 WP_013352869.1 competence type IV pilus minor pilin ComGD Machinery gene
  BUN12_RS08025 (BUN12_1587) comGC 1549125..1549391 (-) 267 WP_044051905.1 competence type IV pilus major pilin ComGC Machinery gene
  BUN12_RS08030 (BUN12_1588) comGB 1549438..1550475 (-) 1038 WP_013352871.1 competence type IV pilus assembly protein ComGB Machinery gene
  BUN12_RS08035 (BUN12_1589) comGA 1550462..1551532 (-) 1071 WP_013352872.1 competence type IV pilus ATPase ComGA Machinery gene
  BUN12_RS08040 (BUN12_1590) - 1551726..1552676 (-) 951 WP_013352873.1 magnesium transporter CorA family protein -
  BUN12_RS08045 (BUN12_1591) - 1552823..1554124 (+) 1302 WP_013352874.1 hemolysin family protein -

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9749.41 Da        Isoelectric Point: 6.7057

>NTDB_id=211529 BUN12_RS08025 WP_044051905.1 1549125..1549391(-) (comGC) [Bacillus amyloliquefaciens strain HK1]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMTDLQSEGYIKKNTACPNGKQILIK
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=211529 BUN12_RS08025 WP_044051905.1 1549125..1549391(-) (comGC) [Bacillus amyloliquefaciens strain HK1]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACGATTCCTAACGTAACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTTCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGAAAAATGC
CGGATATGACCGACTTACAATCAGAGGGATATATCAAAAAGAATACAGCCTGCCCGAATGGAAAACAGATTTTAATAAAG
GGCGGGGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602


Multiple sequence alignment