Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   BUM80_RS00240 Genome accession   NZ_CP018838
Coordinates   40785..40934 (+) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain 11A     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 39114..45018 40785..40934 within 0


Gene organization within MGE regions


Location: 39114..45018
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BUM80_RS00220 - 39114..39918 (+) 805 Protein_39 IS5 family transposase -
  BUM80_RS00225 (BUM80_00230) blpM 40068..40322 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  BUM80_RS00230 (BUM80_00235) blpN 40338..40541 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  BUM80_RS00240 (BUM80_00245) cipB 40785..40934 (+) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  BUM80_RS00245 (BUM80_00250) - 41038..41157 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  BUM80_RS00255 (BUM80_00260) - 41943..42362 (+) 420 WP_000877385.1 hypothetical protein -
  BUM80_RS00260 (BUM80_00265) - 42377..43066 (+) 690 WP_000760521.1 CPBP family intramembrane glutamic endopeptidase -
  BUM80_RS00265 (BUM80_00270) blpZ 43108..43341 (+) 234 WP_000276498.1 immunity protein BlpZ -
  BUM80_RS00275 (BUM80_00285) - 43672..45018 (+) 1347 WP_001838554.1 IS1380-like element ISSpn5 family transposase -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=210799 BUM80_RS00240 WP_001809846.1 40785..40934(+) (cipB) [Streptococcus pneumoniae strain 11A]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=210799 BUM80_RS00240 WP_001809846.1 40785..40934(+) (cipB) [Streptococcus pneumoniae strain 11A]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531

Multiple sequence alignment