Detailed information    

insolico Bioinformatically predicted

Overview


Name   amiF   Type   Regulator
Locus tag   BTR42_RS07520 Genome accession   NZ_CP018822
Coordinates   1491235..1492161 (-) Length   308 a.a.
NCBI ID   WP_077497046.1    Uniprot ID   -
Organism   Streptococcus gallolyticus subsp. gallolyticus DSM 16831     
Function   internalize XIP (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1466050..1531624 1491235..1492161 within 0


Gene organization within MGE regions


Location: 1466050..1531624
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BTR42_RS07415 (BTR42_07115) infC 1466268..1466798 (-) 531 WP_003065423.1 translation initiation factor IF-3 -
  BTR42_RS07420 (BTR42_07120) cmk 1466964..1467644 (-) 681 WP_077497022.1 (d)CMP kinase -
  BTR42_RS07425 (BTR42_07125) - 1467660..1468154 (-) 495 WP_009854460.1 SAG1386/EF1546 family surface-associated protein -
  BTR42_RS07430 (BTR42_07130) - 1468199..1468396 (+) 198 WP_009854461.1 ferredoxin -
  BTR42_RS07435 (BTR42_07135) - 1468383..1468874 (-) 492 WP_009854462.1 EbsA family protein -
  BTR42_RS07440 (BTR42_07140) pepT 1468928..1470145 (-) 1218 WP_077497024.1 peptidase T -
  BTR42_RS07445 (BTR42_07145) - 1470307..1470888 (-) 582 WP_077497026.1 DUF6287 domain-containing protein -
  BTR42_RS07450 (BTR42_07150) - 1470901..1473873 (-) 2973 WP_077497028.1 GBS Bsp-like repeat-containing protein -
  BTR42_RS07455 (BTR42_07155) - 1473989..1475329 (-) 1341 WP_077497030.1 GBS Bsp-like repeat-containing protein -
  BTR42_RS07460 (BTR42_07160) - 1475412..1477001 (-) 1590 WP_077497032.1 beta-carotene 15,15'-monooxygenase -
  BTR42_RS07465 (BTR42_07165) - 1477059..1477985 (-) 927 WP_074581183.1 glycosyltransferase family 2 protein -
  BTR42_RS07470 (BTR42_07170) - 1478104..1479573 (-) 1470 WP_077497034.1 glucosyltransferase domain-containing protein -
  BTR42_RS07475 (BTR42_07175) - 1479593..1482061 (-) 2469 WP_077497036.1 LTA synthase family protein -
  BTR42_RS07480 (BTR42_07180) - 1482058..1483818 (-) 1761 WP_077497038.1 rhamnan synthesis F family protein -
  BTR42_RS07485 (BTR42_07185) - 1483815..1485161 (-) 1347 WP_077497040.1 glycosyltransferase family 2 protein -
  BTR42_RS07490 (BTR42_07190) - 1485158..1486357 (-) 1200 WP_009854474.1 ABC transporter ATP-binding protein -
  BTR42_RS07495 (BTR42_07195) - 1486357..1487163 (-) 807 WP_074581188.1 ABC transporter permease -
  BTR42_RS07500 (BTR42_07200) - 1487160..1488095 (-) 936 WP_077497042.1 glycosyltransferase family 2 protein -
  BTR42_RS07505 (BTR42_07205) cps2T 1488085..1489239 (-) 1155 WP_077497044.1 beta 1-4 rhamnosyltransferase Cps2T -
  BTR42_RS07510 (BTR42_07210) rfbD 1489451..1490305 (-) 855 WP_074581190.1 dTDP-4-dehydrorhamnose reductase -
  BTR42_RS12975 (BTR42_07215) - 1490394..1491110 (-) 717 WP_331852232.1 hypothetical protein -
  BTR42_RS07520 (BTR42_07220) amiF 1491235..1492161 (-) 927 WP_077497046.1 ATP-binding cassette domain-containing protein Regulator
  BTR42_RS07525 (BTR42_07225) amiE 1492172..1493224 (-) 1053 WP_074657565.1 ABC transporter ATP-binding protein Regulator
  BTR42_RS07530 (BTR42_07230) amiD 1493233..1494159 (-) 927 WP_061459706.1 oligopeptide ABC transporter permease OppC Regulator
  BTR42_RS07535 (BTR42_07235) amiC 1494156..1495658 (-) 1503 WP_077497048.1 ABC transporter permease Regulator
  BTR42_RS07540 (BTR42_07240) amiA 1495726..1497696 (-) 1971 WP_077497050.1 peptide ABC transporter substrate-binding protein Regulator
  BTR42_RS07545 (BTR42_07245) - 1498289..1498624 (-) 336 WP_009854479.1 metal-sulfur cluster assembly factor -
  BTR42_RS07550 (BTR42_07250) rpoD 1498646..1499755 (-) 1110 WP_009854480.1 RNA polymerase sigma factor RpoD -
  BTR42_RS07555 (BTR42_07255) dnaG 1499764..1501572 (-) 1809 WP_331852238.1 DNA primase -
  BTR42_RS07560 (BTR42_07260) mscL 1501893..1502270 (+) 378 WP_009854482.1 large conductance mechanosensitive channel protein MscL -
  BTR42_RS07565 (BTR42_07265) rpsU 1502332..1502508 (-) 177 WP_000048058.1 30S ribosomal protein S21 -
  BTR42_RS07570 (BTR42_07270) - 1502905..1504245 (-) 1341 WP_077497054.1 ISLre2 family transposase -
  BTR42_RS07575 (BTR42_07275) - 1504634..1504822 (-) 189 WP_077497056.1 hypothetical protein -
  BTR42_RS07580 (BTR42_07280) - 1504837..1505562 (-) 726 WP_077497058.1 class A sortase -
  BTR42_RS07585 (BTR42_07285) - 1505572..1505760 (-) 189 WP_077497060.1 hypothetical protein -
  BTR42_RS07590 (BTR42_07290) - 1505865..1507484 (-) 1620 WP_077497062.1 helical hairpin domain-containing protein -
  BTR42_RS07595 - 1507456..1507830 (-) 375 WP_077498010.1 plasmid mobilization protein -
  BTR42_RS07605 (BTR42_07300) - 1508141..1508434 (-) 294 WP_012961410.1 hypothetical protein -
  BTR42_RS07610 (BTR42_07305) - 1508483..1512832 (-) 4350 WP_077497063.1 PBECR4 domain-containing protein -
  BTR42_RS07615 (BTR42_07310) - 1512886..1514622 (-) 1737 WP_077497065.1 DNA topoisomerase -
  BTR42_RS07620 (BTR42_07315) - 1514686..1515255 (+) 570 WP_077497067.1 hypothetical protein -
  BTR42_RS07625 (BTR42_07320) - 1515241..1515747 (-) 507 WP_237394383.1 helix-turn-helix domain-containing protein -
  BTR42_RS12675 (BTR42_07325) - 1515788..1515931 (-) 144 WP_167367610.1 hypothetical protein -
  BTR42_RS07630 (BTR42_07330) - 1515967..1517997 (-) 2031 WP_077497071.1 VirD4-like conjugal transfer protein, CD1115 family -
  BTR42_RS07635 (BTR42_07335) - 1517997..1518491 (-) 495 WP_077497073.1 DUF3801 domain-containing protein -
  BTR42_RS07640 (BTR42_07340) - 1518510..1519340 (-) 831 WP_077497075.1 hypothetical protein -
  BTR42_RS07645 (BTR42_07345) - 1519340..1519615 (-) 276 WP_077497077.1 hypothetical protein -
  BTR42_RS07650 (BTR42_07350) - 1519643..1520035 (-) 393 WP_077497079.1 single-stranded DNA-binding protein -
  BTR42_RS07655 (BTR42_07355) - 1520051..1520656 (-) 606 WP_077497081.1 hypothetical protein -
  BTR42_RS07660 (BTR42_07360) - 1520673..1523372 (-) 2700 WP_077497083.1 phage tail tip lysozyme -
  BTR42_RS07665 (BTR42_07365) - 1523411..1523659 (-) 249 WP_077497085.1 hypothetical protein -
  BTR42_RS12980 - 1523992..1524267 (-) 276 Protein_1458 hypothetical protein -
  BTR42_RS07675 (BTR42_07375) - 1524269..1526620 (-) 2352 WP_174564818.1 VirB4-like conjugal transfer ATPase, CD1110 family -
  BTR42_RS07680 (BTR42_07380) - 1526607..1526960 (-) 354 WP_064592500.1 PrgI family mobile element protein -
  BTR42_RS07685 - 1527028..1527264 (-) 237 WP_077497091.1 hypothetical protein -
  BTR42_RS07690 (BTR42_07385) - 1527296..1527949 (+) 654 WP_331852239.1 DUF6710 family protein -
  BTR42_RS07695 (BTR42_07390) - 1527930..1528265 (-) 336 WP_077497095.1 hypothetical protein -
  BTR42_RS07700 (BTR42_07395) - 1528542..1529108 (-) 567 WP_077497097.1 hypothetical protein -
  BTR42_RS07705 (BTR42_07400) - 1529112..1529612 (-) 501 WP_077497099.1 hypothetical protein -
  BTR42_RS07710 (BTR42_07405) - 1529825..1530355 (-) 531 WP_077497101.1 hypothetical protein -
  BTR42_RS07715 (BTR42_07410) - 1530394..1531146 (-) 753 WP_077497103.1 hypothetical protein -

Sequence


Protein


Download         Length: 308 a.a.        Molecular weight: 35073.99 Da        Isoelectric Point: 5.4688

>NTDB_id=210640 BTR42_RS07520 WP_077497046.1 1491235..1492161(-) (amiF) [Streptococcus gallolyticus subsp. gallolyticus DSM 16831]
MSEKLVEIHDLEISFGEGDKRFVAVKNANFFINKGETFSLVGESGSGKTTIGRAIVGLNETSSGDIVYNGKKINGKKSKR
EKEELIRKIQMIFQDPAASLNERATVDYIISEGLYNFKLFKDEEERQKKVKEIIEKVGLLPEHLTRYPHEFSGGQRQRIG
IARTLVMNPEFIIADEPISALDVSVRAQVLNLLKQIQQESGLTYLFIAHDLSVVRFISDRIAVIHQGVIVEVAETEELFK
HPIHPYTQSLLSAIPIPDPILERQKELIIYDPEQHDYTTDKPQMVEIKPNHFVWANQAETEKYQENGE

Nucleotide


Download         Length: 927 bp        

>NTDB_id=210640 BTR42_RS07520 WP_077497046.1 1491235..1492161(-) (amiF) [Streptococcus gallolyticus subsp. gallolyticus DSM 16831]
ATGTCTGAAAAATTAGTTGAAATTCATGATTTGGAAATTTCCTTCGGGGAAGGAGACAAACGGTTTGTAGCTGTCAAAAA
TGCGAATTTCTTCATTAATAAAGGAGAGACTTTTTCGCTAGTGGGCGAATCAGGAAGCGGAAAAACGACCATTGGTCGTG
CAATTGTCGGTCTAAATGAAACCAGTTCAGGTGACATTGTTTACAATGGCAAAAAAATAAATGGTAAGAAATCAAAACGT
GAAAAAGAAGAACTTATCCGAAAAATTCAAATGATTTTTCAAGATCCAGCTGCAAGTTTGAATGAACGTGCTACCGTTGA
TTACATTATTTCAGAAGGGTTGTACAATTTTAAACTGTTTAAGGATGAAGAAGAGCGCCAAAAGAAAGTAAAAGAGATTA
TTGAAAAAGTTGGTTTATTACCAGAACATTTAACGCGCTATCCACACGAGTTTTCAGGTGGTCAACGTCAGCGTATCGGA
ATTGCTAGAACACTTGTTATGAATCCTGAATTTATCATTGCAGATGAACCGATTTCGGCTCTTGATGTTTCAGTCAGGGC
GCAGGTTCTCAATCTTTTAAAACAAATTCAACAAGAAAGTGGTTTAACTTATCTATTTATCGCTCATGATTTATCAGTTG
TTCGCTTTATTTCTGATCGTATTGCGGTTATTCACCAAGGAGTGATTGTTGAAGTGGCAGAAACTGAGGAGCTGTTCAAG
CATCCTATCCACCCTTATACTCAATCACTTTTATCAGCGATTCCAATTCCAGATCCTATTTTGGAGCGCCAAAAAGAATT
AATTATCTACGACCCAGAGCAACACGATTACACAACCGACAAACCACAAATGGTTGAAATTAAACCCAATCACTTCGTCT
GGGCAAATCAAGCCGAAACTGAGAAATATCAAGAGAATGGTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  amiF Streptococcus thermophilus LMG 18311

78.689

99.026

0.779

  amiF Streptococcus thermophilus LMD-9

78.361

99.026

0.776

  amiF Streptococcus salivarius strain HSISS4

78.033

99.026

0.773


Multiple sequence alignment