Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   BXP04_RS07570 Genome accession   NZ_CP024076
Coordinates   1554468..1554581 (-) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   Q9ZEL1
Organism   Helicobacter pylori strain 7.13_R2c     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1549468..1559581
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BXP04_RS07550 (BXP04_07540) - 1550134..1551546 (-) 1413 WP_001861341.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  BXP04_RS07555 (BXP04_07545) comB10 1551616..1552752 (-) 1137 WP_001045869.1 DNA type IV secretion system protein ComB10 Machinery gene
  BXP04_RS07560 (BXP04_07550) comB9 1552745..1553728 (-) 984 WP_001861340.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  BXP04_RS07565 (BXP04_07555) comB8 1553728..1554471 (-) 744 WP_000660520.1 type IV secretion system protein Machinery gene
  BXP04_RS07570 (BXP04_07560) comB7 1554468..1554581 (-) 114 WP_001217873.1 hypothetical protein Machinery gene
  BXP04_RS07575 (BXP04_07565) comB6 1554597..1555652 (-) 1056 WP_000786677.1 P-type conjugative transfer protein TrbL Machinery gene
  BXP04_RS07580 (BXP04_07570) - 1555660..1556655 (-) 996 WP_000468428.1 PDZ domain-containing protein -
  BXP04_RS07585 (BXP04_07575) - 1556655..1556957 (-) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  BXP04_RS07590 (BXP04_07580) panD 1556960..1557313 (-) 354 WP_000142236.1 aspartate 1-decarboxylase -
  BXP04_RS07595 (BXP04_07585) - 1557303..1559528 (-) 2226 WP_001051506.1 AAA family ATPase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=210224 BXP04_RS07570 WP_001217873.1 1554468..1554581(-) (comB7) [Helicobacter pylori strain 7.13_R2c]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=210224 BXP04_RS07570 WP_001217873.1 1554468..1554581(-) (comB7) [Helicobacter pylori strain 7.13_R2c]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9ZEL1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1