Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | BSZ43_RS17970 | Genome accession | NZ_CP018249 |
| Coordinates | 3439995..3440279 (-) | Length | 94 a.a. |
| NCBI ID | WP_073358640.1 | Uniprot ID | - |
| Organism | Bacillus sp. H15-1 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3394293..3445150 | 3439995..3440279 | within | 0 |
Gene organization within MGE regions
Location: 3394293..3445150
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSZ43_RS17680 (BSZ43_17680) | - | 3394293..3394883 (+) | 591 | WP_003185308.1 | hypothetical protein | - |
| BSZ43_RS17685 (BSZ43_17685) | - | 3394985..3395359 (+) | 375 | Protein_3436 | YolD-like family protein | - |
| BSZ43_RS17690 (BSZ43_17690) | - | 3395767..3396477 (-) | 711 | WP_003185310.1 | DUF421 domain-containing protein | - |
| BSZ43_RS17695 (BSZ43_17695) | - | 3396685..3397536 (+) | 852 | WP_035334177.1 | ferritin family protein | - |
| BSZ43_RS17700 (BSZ43_17700) | - | 3397692..3398285 (+) | 594 | WP_003185315.1 | cupin domain-containing protein | - |
| BSZ43_RS17705 (BSZ43_17705) | - | 3398406..3399359 (-) | 954 | WP_003185317.1 | glycoside hydrolase family 25 protein | - |
| BSZ43_RS17710 (BSZ43_17710) | - | 3399407..3399670 (-) | 264 | WP_003185319.1 | phage holin | - |
| BSZ43_RS17715 (BSZ43_17715) | - | 3399686..3399955 (-) | 270 | WP_003185322.1 | hemolysin XhlA family protein | - |
| BSZ43_RS17720 (BSZ43_17720) | - | 3400018..3400203 (-) | 186 | WP_003185324.1 | XkdX family protein | - |
| BSZ43_RS17725 (BSZ43_17725) | - | 3400200..3400523 (-) | 324 | WP_003185326.1 | bZIP transcription factor | - |
| BSZ43_RS17730 (BSZ43_17730) | - | 3400536..3401873 (-) | 1338 | WP_003185328.1 | BppU family phage baseplate upper protein | - |
| BSZ43_RS22265 (BSZ43_17735) | - | 3401894..3403939 (-) | 2046 | WP_035334112.1 | hypothetical protein | - |
| BSZ43_RS17740 (BSZ43_17740) | - | 3403976..3405688 (-) | 1713 | WP_073358624.1 | phage tail protein | - |
| BSZ43_RS17745 (BSZ43_17745) | - | 3405701..3406537 (-) | 837 | WP_003185333.1 | phage tail family protein | - |
| BSZ43_RS17750 (BSZ43_17750) | - | 3406537..3411009 (-) | 4473 | WP_073358626.1 | phage tail tape measure protein | - |
| BSZ43_RS17755 (BSZ43_17755) | - | 3411217..3411579 (-) | 363 | WP_073358627.1 | hypothetical protein | - |
| BSZ43_RS17760 (BSZ43_17760) | - | 3411633..3412250 (-) | 618 | WP_003185341.1 | major tail protein | - |
| BSZ43_RS17765 (BSZ43_17765) | - | 3412265..3412648 (-) | 384 | WP_003185344.1 | hypothetical protein | - |
| BSZ43_RS17770 (BSZ43_17770) | - | 3412645..3413043 (-) | 399 | WP_003185346.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| BSZ43_RS17775 (BSZ43_17775) | - | 3413043..3413351 (-) | 309 | WP_003185349.1 | phage head closure protein | - |
| BSZ43_RS17780 (BSZ43_17780) | - | 3413341..3413643 (-) | 303 | WP_003185351.1 | head-tail connector protein | - |
| BSZ43_RS17785 (BSZ43_17785) | - | 3413664..3414090 (-) | 427 | Protein_3456 | collagen-like protein | - |
| BSZ43_RS17790 (BSZ43_17790) | - | 3414114..3415397 (-) | 1284 | Protein_3457 | phage major capsid protein | - |
| BSZ43_RS17795 (BSZ43_17795) | - | 3415436..3416167 (-) | 732 | WP_021837714.1 | head maturation protease, ClpP-related | - |
| BSZ43_RS17800 (BSZ43_17800) | - | 3416330..3417421 (-) | 1092 | WP_232230667.1 | phage portal protein | - |
| BSZ43_RS17805 (BSZ43_17805) | - | 3417422..3417613 (-) | 192 | WP_073358629.1 | DUF1056 family protein | - |
| BSZ43_RS17810 (BSZ43_17810) | - | 3417625..3419334 (-) | 1710 | WP_025807610.1 | terminase TerL endonuclease subunit | - |
| BSZ43_RS17815 (BSZ43_17815) | - | 3419331..3419846 (-) | 516 | WP_026080867.1 | phage terminase small subunit P27 family | - |
| BSZ43_RS17825 (BSZ43_17825) | - | 3420076..3420450 (-) | 375 | WP_021837717.1 | HNH endonuclease | - |
| BSZ43_RS17830 (BSZ43_17830) | - | 3420477..3420785 (-) | 309 | WP_073358674.1 | hypothetical protein | - |
| BSZ43_RS17835 (BSZ43_17835) | cotD | 3421006..3421230 (-) | 225 | WP_006637235.1 | spore coat protein CotD | - |
| BSZ43_RS17840 (BSZ43_17840) | - | 3421981..3422361 (-) | 381 | WP_009329244.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| BSZ43_RS17845 (BSZ43_17845) | - | 3422474..3422851 (-) | 378 | WP_025807623.1 | YopX family protein | - |
| BSZ43_RS17850 (BSZ43_17850) | - | 3422867..3423382 (-) | 516 | WP_073358632.1 | putative metallopeptidase | - |
| BSZ43_RS17855 (BSZ43_17855) | - | 3423385..3423555 (-) | 171 | WP_071583658.1 | Fur-regulated basic protein FbpA | - |
| BSZ43_RS17860 (BSZ43_17860) | - | 3423552..3424091 (-) | 540 | WP_073358634.1 | ERCC4 domain-containing protein | - |
| BSZ43_RS17865 (BSZ43_17865) | - | 3424088..3424525 (-) | 438 | WP_073358636.1 | hypothetical protein | - |
| BSZ43_RS17870 (BSZ43_17870) | - | 3424503..3424766 (-) | 264 | WP_016886542.1 | hypothetical protein | - |
| BSZ43_RS17875 (BSZ43_17875) | - | 3425042..3427474 (-) | 2433 | WP_073358638.1 | phage/plasmid primase, P4 family | - |
| BSZ43_RS17880 (BSZ43_17880) | - | 3427535..3427972 (-) | 438 | WP_061565940.1 | DUF669 domain-containing protein | - |
| BSZ43_RS17885 (BSZ43_17885) | - | 3427972..3428904 (-) | 933 | WP_061565941.1 | AAA family ATPase | - |
| BSZ43_RS17890 (BSZ43_17890) | - | 3428908..3429465 (-) | 558 | WP_061565942.1 | host-nuclease inhibitor Gam family protein | - |
| BSZ43_RS17895 (BSZ43_17895) | - | 3429558..3429800 (-) | 243 | WP_011198322.1 | hypothetical protein | - |
| BSZ43_RS17900 (BSZ43_17900) | - | 3429888..3430154 (-) | 267 | WP_061565943.1 | YqaH family protein | - |
| BSZ43_RS17905 (BSZ43_17905) | - | 3430214..3430594 (+) | 381 | WP_003185396.1 | DUF2513 domain-containing protein | - |
| BSZ43_RS21910 | - | 3430586..3430756 (-) | 171 | WP_003185398.1 | hypothetical protein | - |
| BSZ43_RS17910 (BSZ43_17910) | - | 3431100..3431654 (-) | 555 | WP_003185401.1 | hypothetical protein | - |
| BSZ43_RS17915 (BSZ43_17915) | - | 3431712..3431900 (-) | 189 | WP_016886536.1 | hypothetical protein | - |
| BSZ43_RS17920 (BSZ43_17920) | - | 3432032..3432220 (-) | 189 | WP_003185403.1 | helix-turn-helix domain-containing protein | - |
| BSZ43_RS17925 (BSZ43_17925) | - | 3432217..3433012 (-) | 796 | Protein_3484 | ORF6N domain-containing protein | - |
| BSZ43_RS17935 (BSZ43_17935) | - | 3433433..3434071 (+) | 639 | WP_003185408.1 | XRE family transcriptional regulator | - |
| BSZ43_RS17940 (BSZ43_17940) | - | 3434142..3435236 (+) | 1095 | WP_003185410.1 | site-specific integrase | - |
| BSZ43_RS17950 (BSZ43_17950) | smpB | 3435800..3436273 (-) | 474 | WP_009329604.1 | SsrA-binding protein SmpB | - |
| BSZ43_RS17955 (BSZ43_17955) | rnr | 3436385..3438691 (-) | 2307 | Protein_3488 | ribonuclease R | - |
| BSZ43_RS17960 (BSZ43_17960) | - | 3438705..3439446 (-) | 742 | Protein_3489 | carboxylesterase | - |
| BSZ43_RS17965 (BSZ43_17965) | secG | 3439594..3439824 (-) | 231 | WP_003185418.1 | preprotein translocase subunit SecG | - |
| BSZ43_RS17970 (BSZ43_17970) | abrB | 3439995..3440279 (-) | 285 | WP_073358640.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| BSZ43_RS17975 (BSZ43_17975) | - | 3440308..3440541 (-) | 234 | WP_085959538.1 | helix-turn-helix transcriptional regulator | - |
| BSZ43_RS17980 (BSZ43_17980) | - | 3440694..3441095 (+) | 402 | WP_009329609.1 | transcriptional regulator | - |
| BSZ43_RS17985 (BSZ43_17985) | - | 3441265..3441663 (+) | 399 | WP_009329610.1 | helix-turn-helix transcriptional regulator | - |
| BSZ43_RS17990 (BSZ43_17990) | - | 3441711..3442388 (-) | 678 | WP_003185432.1 | ABC transporter permease | - |
| BSZ43_RS17995 (BSZ43_17995) | opuCC | 3442405..3443322 (-) | 918 | WP_009329611.1 | osmoprotectant ABC transporter substrate-binding lipoprotein OpuCC | - |
| BSZ43_RS18000 (BSZ43_18000) | - | 3443336..3443989 (-) | 654 | WP_009329612.1 | ABC transporter permease | - |
| BSZ43_RS18005 (BSZ43_18005) | - | 3444011..3445150 (-) | 1140 | WP_003185439.1 | betaine/proline/choline family ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 94 a.a. Molecular weight: 10532.45 Da Isoelectric Point: 7.7837
>NTDB_id=207608 BSZ43_RS17970 WP_073358640.1 3439995..3440279(-) (abrB) [Bacillus sp. H15-1]
MKNTGIVRRIDELGRVVLPVEMRRVLNINEKDPLEIYTDGENIILTKYAANMACLMTGDITTKNKTYAGCKIVLSPRGAE
MLLEDMMAALSEKK
MKNTGIVRRIDELGRVVLPVEMRRVLNINEKDPLEIYTDGENIILTKYAANMACLMTGDITTKNKTYAGCKIVLSPRGAE
MLLEDMMAALSEKK
Nucleotide
Download Length: 285 bp
>NTDB_id=207608 BSZ43_RS17970 WP_073358640.1 3439995..3440279(-) (abrB) [Bacillus sp. H15-1]
GTGAAAAATACCGGGATTGTCCGGAGAATCGATGAGCTCGGCAGAGTCGTTCTCCCGGTCGAAATGCGCAGGGTGCTGAA
TATCAATGAAAAGGACCCGCTCGAAATATATACCGACGGCGAAAACATCATTTTGACAAAATACGCCGCAAACATGGCAT
GTTTGATGACCGGCGACATCACCACGAAAAATAAAACGTATGCGGGCTGCAAAATCGTACTCAGCCCGCGCGGAGCGGAA
ATGCTCCTGGAAGATATGATGGCGGCACTGTCAGAAAAGAAATAA
GTGAAAAATACCGGGATTGTCCGGAGAATCGATGAGCTCGGCAGAGTCGTTCTCCCGGTCGAAATGCGCAGGGTGCTGAA
TATCAATGAAAAGGACCCGCTCGAAATATATACCGACGGCGAAAACATCATTTTGACAAAATACGCCGCAAACATGGCAT
GTTTGATGACCGGCGACATCACCACGAAAAATAAAACGTATGCGGGCTGCAAAATCGTACTCAGCCCGCGCGGAGCGGAA
ATGCTCCTGGAAGATATGATGGCGGCACTGTCAGAAAAGAAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
54.945 |
96.809 |
0.532 |