Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BSZ43_RS16590 Genome accession   NZ_CP018249
Coordinates   3180117..3180257 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus sp. H15-1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3175117..3185257
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSZ43_RS16565 (BSZ43_16565) - 3175414..3175803 (-) 390 WP_003184847.1 hotdog fold thioesterase -
  BSZ43_RS16570 (BSZ43_16570) comA 3175820..3176458 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  BSZ43_RS16575 (BSZ43_16575) comP 3176545..3178851 (-) 2307 WP_003184851.1 ATP-binding protein Regulator
  BSZ43_RS16580 (BSZ43_16580) comX 3178874..3179038 (-) 165 WP_003184853.1 competence pheromone ComX -
  BSZ43_RS16585 (BSZ43_16585) - 3179047..3179928 (-) 882 WP_021837675.1 polyprenyl synthetase family protein -
  BSZ43_RS16590 (BSZ43_16590) degQ 3180117..3180257 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  BSZ43_RS16600 (BSZ43_16600) - 3180743..3181090 (+) 348 WP_231105863.1 SDR family oxidoreductase -
  BSZ43_RS16605 (BSZ43_16605) - 3181133..3182353 (-) 1221 WP_003184864.1 HDOD domain-containing protein -
  BSZ43_RS16610 (BSZ43_16610) - 3182532..3184001 (-) 1470 WP_003184866.1 nicotinate phosphoribosyltransferase -
  BSZ43_RS16615 (BSZ43_16615) - 3184019..3184570 (-) 552 WP_003184868.1 isochorismatase family cysteine hydrolase -
  BSZ43_RS16620 (BSZ43_16620) - 3184755..3185156 (-) 402 WP_003184870.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=207605 BSZ43_RS16590 WP_003184860.1 3180117..3180257(-) (degQ) [Bacillus sp. H15-1]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=207605 BSZ43_RS16590 WP_003184860.1 3180117..3180257(-) (degQ) [Bacillus sp. H15-1]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652

Multiple sequence alignment