Detailed information NTG0207244

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: BSR30_RS07925
• Genome accession: NZ_CP018205
• Coordinates: 1556743..1557054 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain HG001 isolate RN1
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1551743..1562054

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BSR30_RS07890	gcvPA	1552245..1553591 (-)	1347	WP_000019687.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
BSR30_RS07895	gcvT	1553611..1554702 (-)	1092	WP_000093349.1	glycine cleavage system aminomethyltransferase GcvT	-
BSR30_RS07900	-	1554861..1555385 (-)	525	WP_001015117.1	shikimate kinase	-
BSR30_RS07905	-	1555375..1555521 (-)	147	WP_001789879.1	hypothetical protein	-
BSR30_RS07910	comGF	1555618..1556115 (-)	498	WP_001789864.1	competence type IV pilus minor pilin ComGF	Machinery gene
BSR30_RS07915	comGE	1556033..1556332 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
BSR30_RS07920	comGD	1556319..1556765 (-)	447	WP_001790850.1	competence type IV pilus minor pilin ComGD	Machinery gene
BSR30_RS07925	comGC	1556743..1557054 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
BSR30_RS07930	comGB	1557068..1558138 (-)	1071	Protein_1485	competence type IV pilus assembly protein ComGB	-
BSR30_RS07935	comGA	1558110..1559084 (-)	975	WP_000697228.1	competence type IV pilus ATPase ComGA	Machinery gene
BSR30_RS07940	-	1559136..1559759 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
BSR30_RS07945	-	1559756..1560085 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
BSR30_RS07950	-	1560085..1561071 (-)	987	WP_000161314.1	ROK family glucokinase	-
BSR30_RS07955	-	1561068..1561271 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=207244 BSR30_RS07925 WP_000472256.1 1556743..1557054(-) (comGC) [Staphylococcus aureus strain HG001 isolate RN1]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=207244 BSR30_RS07925 WP_000472256.1 1556743..1557054(-) (comGC) [Staphylococcus aureus strain HG001 isolate RN1]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369