Detailed information    

insolico Bioinformatically predicted

Overview

Name   comC/comC1   Type   Regulator
Locus tag   SMA_1909 Genome accession   HE613569
Coordinates   1848944..1849084 (+) Length   46 a.a.
NCBI ID   CCF03200.1    Uniprot ID   -
Organism   Streptococcus macedonicus ACA-DC 198     
Function   binding to ComD; induce autophosphorylation of ComD (predicted from homology)   
Competence regulation

Genomic Context

Location: 1843944..1854084
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SMA_1899 thiN 1844060..1844689 (-) 630 CCF03190.1 Thiamin pyrophosphokinase -
  SMA_1900 rpe 1844686..1845345 (-) 660 CCF03191.1 Ribulose-phosphate 3-epimerase -
  SMA_1901 - 1845352..1846224 (-) 873 CCF03192.1 Ribosome small subunit-stimulated GTPase EngC -
  SMA_1902 - 1846666..1846923 (-) 258 CCF03193.1 Hypothetical protein -
  SMA_1903 comD/comD3 1847053..1847367 (-) 315 CCF03194.1 Histidine kinase of the competence regulon ComD Regulator
  SMA_1904 - 1847499..1847645 (-) 147 CCF03195.1 Hypothetical protein -
  SMA_1905 - 1847941..1848252 (-) 312 CCF03196.1 Conserved hypothetical protein -
  SMA_1906 - 1848264..1848413 (-) 150 CCF03197.1 Hypothetical protein -
  SMA_1907 - 1848423..1848602 (-) 180 CCF03198.1 Hypothetical protein -
  SMA_1908 - 1848544..1848723 (-) 180 CCF03199.1 Hypothetical protein -
  SMA_1909 comC/comC1 1848944..1849084 (+) 141 CCF03200.1 Hypothetical protein Regulator
  SMA_1910 comD/comD1 1849102..1850409 (-) 1308 CCF03201.1 Histidine kinase of the competence regulon ComD Regulator
  SMA_1911 comE/comE1 1850417..1851148 (-) 732 CCF03202.1 Response regulator of the competence regulon ComE Regulator
  SMA_1912 - 1851165..1851491 (-) 327 CCF03203.1 BlpS protein -
  SMA_1913 nisX1 1851651..1852505 (-) 855 CCF03204.1 Transposase -
  SMA_1914 - 1852502..1852762 (-) 261 CCF03205.1 Transposase -
  SMA_1915 - 1852920..1853051 (-) 132 CCF03206.1 Hypothetical protein -
  SMA_1916 - 1853159..1853266 (-) 108 Protein_1915 Hypothetical protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5471.41 Da        Isoelectric Point: 10.2565

>NTDB_id=20689 SMA_1909 CCF03200.1 1848944..1849084(+) (comC/comC1) [Streptococcus macedonicus ACA-DC 198]
MMTEKMFKELNQSELEKTIGGKNKDFLIVGPFDWFKKHQGKSQKHM

Nucleotide


Download         Length: 141 bp        

>NTDB_id=20689 SMA_1909 CCF03200.1 1848944..1849084(+) (comC/comC1) [Streptococcus macedonicus ACA-DC 198]
ATGATGACAGAAAAAATGTTTAAAGAATTAAATCAATCCGAATTAGAGAAAACGATTGGTGGAAAGAATAAGGATTTCTT
AATTGTTGGACCTTTCGATTGGTTTAAAAAACATCAAGGGAAATCACAAAAACACATGTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comC/comC1 Streptococcus equinus JB1

56.667

65.217

0.37

Multiple sequence alignment