Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BSR08_RS12425 Genome accession   NZ_CP018184
Coordinates   2295872..2296012 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain KH2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2290872..2301012
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSR08_RS12400 (BSR08_12590) yuxO 2291149..2291529 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  BSR08_RS12405 (BSR08_12595) comA 2291548..2292192 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  BSR08_RS12410 (BSR08_12600) comP 2292273..2294585 (-) 2313 WP_014480703.1 sensor histidine kinase Regulator
  BSR08_RS12415 (BSR08_12605) comX 2294601..2294822 (-) 222 WP_014480704.1 competence pheromone ComX -
  BSR08_RS12420 (BSR08_12610) - 2294824..2295687 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  BSR08_RS12425 (BSR08_12615) degQ 2295872..2296012 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  BSR08_RS22885 - 2296234..2296359 (+) 126 WP_003228793.1 hypothetical protein -
  BSR08_RS12430 (BSR08_12620) - 2296473..2296841 (+) 369 WP_014477834.1 hypothetical protein -
  BSR08_RS12435 (BSR08_12625) pdeH 2296817..2298046 (-) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  BSR08_RS12440 (BSR08_12630) pncB 2298182..2299654 (-) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -
  BSR08_RS12445 (BSR08_12635) pncA 2299670..2300221 (-) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  BSR08_RS12450 (BSR08_12640) yueI 2300318..2300716 (-) 399 WP_014480710.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=206721 BSR08_RS12425 WP_003220708.1 2295872..2296012(-) (degQ) [Bacillus subtilis strain KH2]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=206721 BSR08_RS12425 WP_003220708.1 2295872..2296012(-) (degQ) [Bacillus subtilis strain KH2]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment