Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   BSR08_RS09510 Genome accession   NZ_CP018184
Coordinates   1730806..1731216 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis strain KH2     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1726173..1754102 1730806..1731216 within 0


Gene organization within MGE regions


Location: 1726173..1754102
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSR08_RS09485 (BSR08_09635) yqeF 1726340..1727071 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  BSR08_RS09490 (BSR08_09640) cwlH 1727323..1728075 (-) 753 WP_014480318.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  BSR08_RS09495 (BSR08_09645) yqeD 1728262..1728888 (+) 627 WP_014480319.1 TVP38/TMEM64 family protein -
  BSR08_RS09500 (BSR08_09650) gnd 1728907..1729800 (-) 894 WP_014480320.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  BSR08_RS09505 (BSR08_09655) yqeB 1730051..1730773 (+) 723 WP_014480321.1 hypothetical protein -
  BSR08_RS09510 (BSR08_09660) nucA/comI 1730806..1731216 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  BSR08_RS09515 (BSR08_09665) sigK 1731412..1732140 (+) 729 WP_013308023.1 RNA polymerase sporulation sigma factor SigK -
  BSR08_RS22790 (BSR08_09670) - 1732140..1732238 (+) 99 WP_031600702.1 hypothetical protein -
  BSR08_RS23355 - 1732235..1732447 (-) 213 Protein_1881 recombinase family protein -
  BSR08_RS09525 (BSR08_09680) fumC 1732666..1734054 (-) 1389 WP_014480325.1 class II fumarate hydratase -
  BSR08_RS09530 (BSR08_09685) - 1734221..1735111 (+) 891 WP_014480326.1 LysR family transcriptional regulator -
  BSR08_RS09535 (BSR08_09690) - 1736053..1736448 (+) 396 WP_014480327.1 VOC family protein -
  BSR08_RS09545 (BSR08_09700) - 1737188..1738315 (-) 1128 WP_014480328.1 Rap family tetratricopeptide repeat protein -
  BSR08_RS23605 (BSR08_09705) - 1738497..1740423 (+) 1927 Protein_1886 T7SS effector LXG polymorphic toxin -
  BSR08_RS09555 (BSR08_09710) - 1740437..1740724 (+) 288 WP_014480331.1 hypothetical protein -
  BSR08_RS09560 (BSR08_09715) - 1741127..1741567 (+) 441 WP_014480332.1 SMI1/KNR4 family protein -
  BSR08_RS09565 (BSR08_09720) - 1741666..1742118 (+) 453 WP_014480333.1 SMI1/KNR4 family protein -
  BSR08_RS09570 (BSR08_09725) cdiI 1742215..1742574 (+) 360 WP_014480334.1 ribonuclease toxin immunity protein CdiI -
  BSR08_RS09575 (BSR08_09730) - 1742679..1743158 (+) 480 WP_224588637.1 hypothetical protein -
  BSR08_RS22800 - 1743466..1743669 (-) 204 WP_123772462.1 hypothetical protein -
  BSR08_RS09580 (BSR08_09735) - 1743758..1743991 (+) 234 WP_224588641.1 hypothetical protein -
  BSR08_RS09585 (BSR08_09740) atxG 1744259..1744836 (+) 578 Protein_1894 suppressor of fused domain protein -
  BSR08_RS09590 (BSR08_09745) - 1744946..1745236 (+) 291 WP_014480337.1 contact-dependent growth inhibition system immunity protein -
  BSR08_RS09600 (BSR08_09755) istA 1746077..1747624 (+) 1548 WP_014480339.1 IS21 family transposase -
  BSR08_RS09605 (BSR08_09760) istB 1747621..1748379 (+) 759 WP_014479891.1 IS21-like element helper ATPase IstB -
  BSR08_RS23375 - 1748697..1748794 (-) 98 Protein_1898 N-acetylmuramoyl-L-alanine amidase -
  BSR08_RS09615 (BSR08_09770) - 1748972..1749058 (+) 87 WP_072592549.1 putative holin-like toxin -
  BSR08_RS23700 (BSR08_09775) - 1749345..1749781 (-) 437 Protein_1900 phage tail tube protein -
  BSR08_RS23080 (BSR08_09780) terS 1749779..1750344 (-) 566 Protein_1901 phage terminase small subunit -
  BSR08_RS22810 - 1750471..1750776 (+) 306 WP_123772463.1 hypothetical protein -
  BSR08_RS23390 - 1750949..1751014 (-) 66 Protein_1903 hypothetical protein -
  BSR08_RS09630 (BSR08_09785) - 1751169..1751648 (-) 480 WP_014480344.1 hypothetical protein -
  BSR08_RS09635 (BSR08_09790) - 1752265..1752531 (+) 267 WP_033881358.1 hypothetical protein -
  BSR08_RS09640 (BSR08_09795) - 1752670..1752822 (-) 153 WP_049832653.1 XtrA/YqaO family protein -
  BSR08_RS09645 (BSR08_09800) - 1752905..1753027 (-) 123 Protein_1907 RusA family crossover junction endodeoxyribonuclease -
  BSR08_RS09650 (BSR08_09805) - 1752990..1753238 (-) 249 Protein_1908 hypothetical protein -
  BSR08_RS23395 - 1753383..1753613 (-) 231 WP_224588644.1 hypothetical protein -
  BSR08_RS09660 (BSR08_09815) - 1753922..1754102 (-) 181 Protein_1910 hypothetical protein -

Sequence


Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=206710 BSR08_RS09510 WP_009967785.1 1730806..1731216(-) (nucA/comI) [Bacillus subtilis strain KH2]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=206710 BSR08_RS09510 WP_009967785.1 1730806..1731216(-) (nucA/comI) [Bacillus subtilis strain KH2]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529


Multiple sequence alignment