Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   BP422_RS05015 Genome accession   NZ_CP018145
Coordinates   1014113..1014502 (-) Length   129 a.a.
NCBI ID   WP_088906808.1    Uniprot ID   -
Organism   Brevibacillus formosus strain NF2     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 988511..1013748 1014113..1014502 flank 365


Gene organization within MGE regions


Location: 988511..1014502
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BP422_RS04870 (BP422_04765) - 988511..989074 (+) 564 WP_088906789.1 hypothetical protein -
  BP422_RS04875 (BP422_04770) - 989201..989596 (+) 396 WP_088906790.1 sigma-70 family RNA polymerase sigma factor -
  BP422_RS04880 (BP422_04775) - 990157..990777 (-) 621 WP_088906791.1 hypothetical protein -
  BP422_RS04885 (BP422_04780) - 991249..991494 (+) 246 WP_088906792.1 hypothetical protein -
  BP422_RS04890 (BP422_04785) - 991816..994743 (+) 2928 WP_088906793.1 S8 family serine peptidase -
  BP422_RS04895 (BP422_04790) - 994894..995073 (+) 180 WP_236841291.1 hypothetical protein -
  BP422_RS04900 (BP422_04795) - 995085..995249 (+) 165 WP_236841292.1 hypothetical protein -
  BP422_RS04905 (BP422_04805) - 995695..996884 (+) 1190 WP_088906794.1 IS3 family transposase -
  BP422_RS04910 (BP422_04810) - 996964..997470 (+) 507 WP_236841293.1 hypothetical protein -
  BP422_RS04915 (BP422_04815) - 997489..998094 (+) 606 WP_088906796.1 hypothetical protein -
  BP422_RS31905 - 998322..998465 (+) 144 WP_236841294.1 hypothetical protein -
  BP422_RS31910 (BP422_04820) - 998524..999375 (-) 852 WP_236841295.1 hypothetical protein -
  BP422_RS04930 (BP422_04825) - 999713..1001212 (+) 1500 WP_088906797.1 recombinase family protein -
  BP422_RS04935 (BP422_04830) - 1001246..1001620 (+) 375 Protein_977 sigma-70 family RNA polymerase sigma factor -
  BP422_RS32665 - 1001999..1002346 (-) 348 WP_335633119.1 DUF2834 domain-containing protein -
  BP422_RS31645 (BP422_04835) istA 1002345..1003853 (+) 1509 WP_205669420.1 IS21 family transposase -
  BP422_RS04950 (BP422_04840) istB 1003850..1004593 (+) 744 WP_088906798.1 IS21-like element helper ATPase IstB -
  BP422_RS32670 - 1004668..1004817 (-) 150 WP_335633106.1 DUF2834 domain-containing protein -
  BP422_RS04960 (BP422_04845) - 1004933..1005424 (-) 492 WP_088906799.1 hypothetical protein -
  BP422_RS04965 (BP422_04850) - 1006189..1006467 (+) 279 WP_088906800.1 hypothetical protein -
  BP422_RS04970 (BP422_04855) - 1006496..1006879 (+) 384 WP_088906801.1 hypothetical protein -
  BP422_RS04975 - 1007518..1007787 (+) 270 WP_205669442.1 hypothetical protein -
  BP422_RS04980 (BP422_04860) - 1008142..1009332 (+) 1191 WP_088906802.1 hypothetical protein -
  BP422_RS30930 - 1009735..1009872 (-) 138 WP_157696737.1 hypothetical protein -
  BP422_RS04985 (BP422_04865) - 1010215..1010520 (-) 306 WP_088906803.1 NIPSNAP family protein -
  BP422_RS04990 (BP422_04870) - 1010634..1010891 (-) 258 WP_088906804.1 hypothetical protein -
  BP422_RS04995 (BP422_04875) - 1011055..1011600 (-) 546 WP_088906805.1 GNAT family N-acetyltransferase -
  BP422_RS05000 - 1011855..1012040 (-) 186 WP_088906806.1 type Z 30S ribosomal protein S14 -
  BP422_RS05005 (BP422_04880) - 1012196..1012462 (-) 267 WP_335633107.1 DUF2512 family protein -
  BP422_RS05010 (BP422_04885) - 1013302..1013748 (-) 447 WP_088906807.1 hypothetical protein -
  BP422_RS05015 (BP422_04890) nucA/comI 1014113..1014502 (-) 390 WP_088906808.1 NucA/NucB deoxyribonuclease domain-containing protein Machinery gene

Sequence

Protein


Download         Length: 129 a.a.        Molecular weight: 14030.76 Da        Isoelectric Point: 4.6651

>NTDB_id=206358 BP422_RS05015 WP_088906808.1 1014113..1014502(-) (nucA/comI) [Brevibacillus formosus strain NF2]
MLGGVIIGQELILEDKTVNNKDVVHTIVFPSDRYPETAKHIKEAIASGESAVCTIDRDGADENRTESLKGIPTKKGYDRD
EWPMAMCAEGGAGAHIKYITPSDNRGAGSWISNQLEDFPDGTKVEIVVK

Nucleotide


Download         Length: 390 bp        

>NTDB_id=206358 BP422_RS05015 WP_088906808.1 1014113..1014502(-) (nucA/comI) [Brevibacillus formosus strain NF2]
ATGCTTGGCGGTGTTATTATTGGTCAAGAACTTATATTGGAGGACAAAACTGTCAACAACAAGGACGTCGTCCATACAAT
AGTTTTTCCGTCTGATCGATACCCAGAAACAGCAAAGCATATCAAAGAAGCGATTGCCTCAGGGGAATCTGCTGTATGCA
CGATTGACCGTGATGGAGCAGATGAAAATCGCACAGAATCATTAAAGGGTATTCCCACAAAAAAGGGATACGATCGAGAC
GAATGGCCGATGGCTATGTGTGCTGAGGGAGGTGCAGGCGCACATATCAAGTACATAACACCTTCGGATAACCGGGGAGC
CGGATCATGGATTTCCAATCAATTAGAGGATTTTCCAGACGGAACAAAAGTTGAAATCGTGGTCAAATAA

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(32-127)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

61.905

97.674

0.605

Multiple sequence alignment