Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BMJ37_RS15285 Genome accession   NZ_CP018133
Coordinates   3090223..3090363 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain ATR2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3085223..3095363
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BMJ37_RS15260 (BMJ37_14795) - 3085563..3085946 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  BMJ37_RS15265 (BMJ37_14800) comA 3085968..3086612 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  BMJ37_RS15270 (BMJ37_14805) comP 3086693..3088984 (-) 2292 WP_099721970.1 histidine kinase Regulator
  BMJ37_RS15275 (BMJ37_14810) comX 3088996..3089160 (-) 165 WP_007613432.1 competence pheromone ComX -
  BMJ37_RS15280 (BMJ37_14815) - 3089160..3090071 (-) 912 WP_022553710.1 polyprenyl synthetase family protein -
  BMJ37_RS15285 (BMJ37_14820) degQ 3090223..3090363 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  BMJ37_RS15295 (BMJ37_14825) - 3090829..3091170 (+) 342 WP_014418765.1 hypothetical protein -
  BMJ37_RS15300 (BMJ37_14830) - 3091177..3092400 (-) 1224 WP_029973798.1 EAL and HDOD domain-containing protein -
  BMJ37_RS15305 (BMJ37_14835) - 3092530..3093996 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  BMJ37_RS15310 (BMJ37_14840) - 3094014..3094565 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  BMJ37_RS15315 (BMJ37_14845) - 3094662..3095060 (-) 399 WP_029973800.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=206005 BMJ37_RS15285 WP_003152043.1 3090223..3090363(-) (degQ) [Bacillus velezensis strain ATR2]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=206005 BMJ37_RS15285 WP_003152043.1 3090223..3090363(-) (degQ) [Bacillus velezensis strain ATR2]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment