Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   BSU_25750 Genome accession   NC_000964
Coordinates   2652387..2652797 (-) Length   136 a.a.
NCBI ID   NP_390452.1    Uniprot ID   P42983
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2647753..2699243 2652387..2652797 within 0


Gene organization within MGE regions


Location: 2647753..2699243
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSU_25700 (BSU25700) yqeF 2647920..2648651 (-) 732 NP_390447.1 putative lipoprotein; putative esterase -
  BSU_25710 (BSU25710) cwlH 2648903..2649655 (-) 753 NP_390448.1 N-acetylmuramoyl-L-alanine amidase -
  BSU_25720 (BSU25720) yqeD 2649842..2650468 (+) 627 NP_390449.1 conserved membrane protein of unknown function -
  BSU_25730 (BSU25730) yqeC 2650487..2651380 (-) 894 NP_390450.1 putative catabolic 6-phospho-gluconate dehydrogenase (NAD[+]-dependent) -
  BSU_25740 (BSU25740) yqeB 2651632..2652354 (+) 723 NP_390451.2 hypothetical protein -
  BSU_25750 (BSU25750) nucA/comI 2652387..2652797 (-) 411 NP_390452.1 sporulation-specific matrix degrading exported DNase Machinery gene
  BSU_25770 (BSU25770) spoIVCA 2653371..2654873 (-) 1503 NP_390454.2 site-specific DNA recombinase; skin element -
  BSU_25780 (BSU25780) arsC 2655322..2655741 (-) 420 NP_390455.1 thioredoxin-coupled arsenate reductase; skin element -
  BSU_25790 (BSU25790) arsB 2655753..2656793 (-) 1041 NP_390456.2 arsenite efflux transporter; skin element -
  BSU_25800 (BSU25800) yqcK 2656816..2657256 (-) 441 NP_390457.2 putative thiol lyase -
  BSU_25810 (BSU25810) arsR 2657317..2657634 (-) 318 NP_390458.1 transcriptional regulator (ArsR-arsenate); skin element -
  BSU_25820 (BSU25820) yqcI 2658006..2658770 (-) 765 NP_390459.2 conserved protein of unknown function; skin element -
  BSU_25830 (BSU25830) rapE 2659213..2660340 (+) 1128 NP_390460.2 response regulator aspartate phosphatase; skin element -
  BSU_25840 (BSU25840) phrE 2660330..2660464 (+) 135 NP_390461.1 regulator peptide of the activity of phosphatase RapE; skin element -
  BSU_25850 (BSU25850) yqzI 2660574..2660732 (+) 159 NP_390462.1 hypothetical protein; skin element -
  BSU_25860 (BSU25860) rttG 2661102..2662697 (+) 1596 NP_390463.1 phage ribonuclease toxin; skin element -
  BSU_25870 (BSU25870) rttF 2662712..2663290 (+) 579 NP_390464.1 antitoxin factor of ribonuclease toxin RttG; skin element -
  BSU_25875 (BSU25875) - 2663408..2663554 (+) 147 YP_009513979.1 hypothetical protein -
  BSU_25880 (BSU25880) yqxJ 2663551..2663913 (-) 363 NP_390465.1 hypothetical protein; skin element -
  BSU_25890 (BSU25890) yqxI 2663929..2664408 (-) 480 NP_390466.1 hypothetical protein; skin element -
  BSU_25900 (BSU25900) cwlA 2664573..2665391 (-) 819 NP_390467.1 N-acetylmuramoyl-L-alanine amidase; skin element -
  BSU_25910 (BSU25910) yqxH 2665436..2665858 (-) 423 NP_390468.1 putative holin; skin element -
  BSU_25920 (BSU25920) yqxG 2665903..2666796 (-) 894 NP_390469.1 putative phage-related lytic exoenzyme; skin element -
  BSU_25930 (BSU25930) yqcE 2666884..2667048 (-) 165 NP_390470.1 conserved phage protein of unknown function; skin element -
  BSU_25940 (BSU25940) yqcD 2667045..2667380 (-) 336 NP_390471.1 conserved phage protein of unknown function; skin element -
  BSU_25950 (BSU25950) yqcC 2667390..2668490 (-) 1101 NP_390472.2 conserved phage protein of unknown function; skin element -
  BSU_25960 (BSU25960) yqcB 2668493..2668765 (-) 273 NP_390473.1 conserved phage protein of unknown function; skin element -
  BSU_25970 (BSU25970) yqcA 2668762..2669340 (-) 579 NP_390474.2 putative phage tail baseplate protein; skin element -
  BSU_25980 (BSU25980) yqbT 2669324..2670370 (-) 1047 NP_390475.1 putative phage baseplate assembly protein; skin element -
  BSU_25990 (BSU25990) yqbS 2670363..2670788 (-) 426 NP_390476.1 conserved phage protein of unknown function; skin element -
  BSU_26000 (BSU26000) yqbR 2670801..2671064 (-) 264 NP_390477.1 conserved phage protein of unknown function; skin element -
  BSU_26010 (BSU26010) yqbQ 2671061..2672041 (-) 981 NP_390478.1 conserved phage protein of unknown function; skin element -
  BSU_26020 (BSU26020) yqbP 2672054..2672713 (-) 660 NP_390479.1 putative phage murein-binding protein; skin element -
  BSU_26030 (BSU26030) yqbO 2672706..2677463 (-) 4758 NP_390480.2 putative tape measure protein; skin element -
  BSU_26050 (BSU26050) txpA 2678240..2678419 (+) 180 NP_390482.1 toxic peptide of toxin-antitoxin system; skin element -
  BSU_26055 (BSU26055) bsrH 2678799..2678888 (+) 90 YP_009513980.1 skin region; type I toxin -
  BSU_26060 (BSU26060) yqbM 2679142..2679585 (-) 444 NP_390483.2 putative tail tube protein; skin element -
  BSU_26075 (BSU26075) yqbK 2679588..2680988 (-) 1401 NP_390485.2 putative phage tail sheath protein; skin element -
  BSU_26089 (BSU26089) yqzN 2680989..2681180 (-) 192 YP_003097763.1 conserved phage protein of unknown function; skin element -
  BSU_26090 (BSU26090) yqbJ 2681177..2681614 (-) 438 NP_390486.2 conserved phage protein of unknown function; skin element -
  BSU_26100 (BSU26100) yqbI 2681627..2682130 (-) 504 NP_390487.1 putative phage tail component; skin element -
  BSU_26110 (BSU26110) yqbH 2682127..2682489 (-) 363 NP_390488.1 conserved phage protein of unknown function; skin element -
  BSU_26120 (BSU26120) yqbG 2682486..2682881 (-) 396 NP_390489.2 conserved phage protein of unknown function; skin element -
  BSU_26130 (BSU26130) yqbF 2682885..2683196 (-) 312 NP_390490.1 hypothetical protein; skin element -
  BSU_26140 (BSU26140) yqbE 2683207..2684142 (-) 936 NP_390491.2 putative phage capsid protein; skin element -
  BSU_26150 (BSU26150) yqbD 2684161..2685129 (-) 969 NP_390492.2 putative nucleic acid-binding protein; skin element -
  BSU_26160 (BSU26160) yqbC 2685162..2685815 (-) 654 NP_390493.1 conserved phage protein of unknown function; skin element -
  BSU_26170 (BSU26170) yqbB 2685856..2686773 (-) 918 NP_390494.1 putative phage head morphogenesis protein; skin element -
  BSU_26180 (BSU26180) yqbA 2686770..2688302 (-) 1533 NP_390495.1 putative phage capsid protein; skin element -
  BSU_26190 (BSU26190) yqaT 2688306..2689601 (-) 1296 NP_390496.1 putative phage-related terminase large subunit; skin element -
  BSU_26200 (BSU26200) yqaS 2689594..2690313 (-) 720 NP_390497.1 putative phage-related terminase small subunit; skin element -
  BSU_26210 (BSU26210) yqaR 2690381..2690845 (-) 465 NP_390498.1 hypothetical protein; skin element -
  BSU_26220 (BSU26220) yqaQ 2690989..2691444 (-) 456 NP_390499.1 putative phage DNA-binding protein; skin element -
  BSU_26230 (BSU26230) yqaP 2691642..2692571 (+) 930 NP_390500.1 conserved phage protein of unknown function; skin element -
  BSU_26240 (BSU26240) yqaO 2692645..2692851 (-) 207 NP_390501.1 conserved phage protein of unknown function; skin element -
  BSU_26250 (BSU26250) yqaN 2692933..2693361 (-) 429 NP_390502.1 putative Holliday junction resolvase; skin element -
  BSU_26259 (BSU26259) yqzO 2693457..2693606 (-) 150 YP_003097764.1 hypothetical protein; skin element -
  BSU_26260 (BSU26260) sknM 2693597..2694538 (-) 942 NP_390503.3 putative helicase loader; skin element -
  BSU_26270 (BSU26270) yqaL 2694420..2695097 (-) 678 NP_390504.2 putative DNA-binding protein; skin element -
  BSU_26280 (BSU26280) yqaK 2695173..2696027 (-) 855 NP_390505.1 putative DNA recombination protein; skin element -
  BSU_26290 (BSU26290) yqaJ 2696030..2696989 (-) 960 NP_390506.1 putative nuclease; skin element -
  BSU_26300 (BSU26300) yqaI 2697095..2697289 (-) 195 NP_390507.1 hypothetical protein; skin element -
  BSU_26305 (BSU26305) - 2697249..2697422 (-) 174 YP_009513981.1 hypothetical protein; skin element -
  BSU_26310 (BSU26310) sknH 2697419..2697676 (-) 258 NP_390508.1 skin element; factor binding to DnaA -
  BSU_26320 (BSU26320) yqaG 2697673..2698242 (-) 570 NP_390509.1 putative transcriptional regulator; skin element -
  BSU_26330 (BSU26330) yqdA 2698316..2698456 (-) 141 NP_390510.1 hypothetical protein; skin element -
  BSU_26340 (BSU26340) yqaF 2698486..2698716 (-) 231 NP_390511.1 putative transcriptional regulator; skin element -
  BSU_26350 (BSU26350) sknR 2698893..2699243 (+) 351 NP_390512.1 skin element; transcriptional repressor of yqaF-yqaN operon (Xre family) -

Sequence


Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=20537 BSU_25750 NP_390452.1 2652387..2652797(-) (nucA/comI) [Bacillus subtilis subsp. subtilis str. 168]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=20537 BSU_25750 NP_390452.1 2652387..2652797(-) (nucA/comI) [Bacillus subtilis subsp. subtilis str. 168]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P42983

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529


Multiple sequence alignment