Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BLL65_RS04390 Genome accession   NZ_CP018007
Coordinates   866415..866555 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain sx01604     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 861415..871555
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BLL65_RS04360 (BLL65_04305) - 861718..862116 (+) 399 WP_003152031.1 YueI family protein -
  BLL65_RS04365 (BLL65_04310) - 862213..862764 (+) 552 WP_003152033.1 cysteine hydrolase family protein -
  BLL65_RS04370 (BLL65_04315) - 862782..864248 (+) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  BLL65_RS04375 (BLL65_04320) - 864378..865601 (+) 1224 WP_032876792.1 EAL and HDOD domain-containing protein -
  BLL65_RS04380 (BLL65_04325) - 865608..865949 (-) 342 WP_032876795.1 hypothetical protein -
  BLL65_RS04390 (BLL65_04335) degQ 866415..866555 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  BLL65_RS04395 (BLL65_04340) - 866763..867623 (+) 861 WP_142925231.1 polyprenyl synthetase family protein -
  BLL65_RS04400 comX 867592..867765 (+) 174 WP_012118314.1 competence pheromone ComX -
  BLL65_RS04405 (BLL65_04345) comP 867779..870079 (+) 2301 WP_032876801.1 histidine kinase Regulator
  BLL65_RS04410 (BLL65_04350) comA 870160..870804 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  BLL65_RS04415 (BLL65_04355) - 870826..871209 (+) 384 WP_007613430.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=204973 BLL65_RS04390 WP_003152043.1 866415..866555(+) (degQ) [Bacillus velezensis strain sx01604]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=204973 BLL65_RS04390 WP_003152043.1 866415..866555(+) (degQ) [Bacillus velezensis strain sx01604]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment