Detailed information    

insolico Bioinformatically predicted

Overview

Name   MMJJ_RS05685   Type   Machinery gene
Locus tag   MJ_RS02275 Genome accession   NC_000909
Coordinates   387129..387347 (-) Length   72 a.a.
NCBI ID   WP_064496494.1    Uniprot ID   -
Organism   Methanocaldococcus jannaschii DSM 2661     
Function   DNA uptake (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 382129..392347
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MJ_RS09615 (MJ0425) - 382314..382712 (+) 399 WP_209320033.1 DUF234 domain-containing protein -
  MJ_RS02250 (MJ0426) - 382698..383234 (-) 537 WP_244409468.1 hypothetical protein -
  MJ_RS02255 (MJ0427) - 383237..383707 (-) 471 WP_064496493.1 hypothetical protein -
  MJ_RS02260 (MJ0428) - 383700..384983 (-) 1284 WP_010869927.1 nucleotide sugar dehydrogenase -
  MJ_RS02265 (MJ0429) - 385151..386338 (+) 1188 WP_010869928.1 argininosuccinate synthase -
  MJ_RS02270 (MJ0430) dcd 386346..386960 (-) 615 WP_010869929.1 dCTP deaminase -
  MJ_RS02275 (MJ0431) MMJJ_RS05685 387129..387347 (-) 219 WP_064496494.1 class III signal peptide-containing protein Machinery gene
  MJ_RS09685 - 387568..387708 (-) 141 WP_244409470.1 hypothetical protein -
  MJ_RS02280 (MJ0432) - 387846..388124 (-) 279 WP_010869931.1 transcriptional regulator -
  MJ_RS02285 (MJ0433) - 388133..388660 (-) 528 WP_010869932.1 hypothetical protein -
  MJ_RS09620 - 388671..389015 (-) 345 WP_064496915.1 gamma-glutamylcyclotransferase family protein -
  MJ_RS09625 - 389028..389339 (-) 312 Protein_457 DUF86 domain-containing protein -
  MJ_RS02295 (MJ0435) - 389336..389617 (-) 282 WP_010869934.1 nucleotidyltransferase family protein -
  MJ_RS02300 (MJ0436) tgtA 389623..391592 (-) 1970 Protein_459 tRNA guanosine(15) transglycosylase TgtA -
  MJ_RS02305 (MJ0437) - 391661..391900 (-) 240 WP_010869936.1 DUF4040 domain-containing protein -

Sequence

Protein


Download         Length: 72 a.a.        Molecular weight: 7574.01 Da        Isoelectric Point: 10.6386

>NTDB_id=20434 MJ_RS02275 WP_064496494.1 387129..387347(-) (MMJJ_RS05685) [Methanocaldococcus jannaschii DSM 2661]
MKILKKLLSKKGQLSMEVGVLVAAAVLVAIIAAYFYVKNAKSAVASAGNKSAAFINVTANKSQEYISNLSNI

Nucleotide


Download         Length: 219 bp        

>NTDB_id=20434 MJ_RS02275 WP_064496494.1 387129..387347(-) (MMJJ_RS05685) [Methanocaldococcus jannaschii DSM 2661]
ATGAAAATCTTAAAGAAATTATTATCAAAGAAAGGGCAGTTATCAATGGAAGTTGGAGTTTTAGTTGCAGCAGCTGTATT
AGTTGCTATAATTGCAGCATACTTCTACGTAAAAAATGCTAAAAGTGCAGTAGCAAGTGCTGGAAATAAATCAGCAGCTT
TTATAAATGTTACTGCTAATAAATCACAGGAATACATTAGTAACTTAAGTAATATTTAA

Domains

Predicted by InterproScan.

Class III signal peptide (Class_IIIsignal)

(10-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  MMJJ_RS05685 Methanococcus maripaludis strain DSM 2067

52.778

100

0.528

Multiple sequence alignment