Detailed information    

insolico Bioinformatically predicted

Overview


Name   ctsT   Type   Machinery gene
Locus tag   BLD38_RS06370 Genome accession   NZ_CP017862
Coordinates   1184000..1184188 (+) Length   62 a.a.
NCBI ID   WP_195182296.1    Uniprot ID   -
Organism   Campylobacter jejuni strain FJ3124     
Function   type II secretion system/type IV pilin; DNA uptake (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1179000..1189188
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BLD38_RS06345 (BLD38_06345) rpsR 1179362..1179622 (+) 261 WP_002853032.1 30S ribosomal protein S18 -
  BLD38_RS06350 (BLD38_06350) lon 1179683..1182058 (-) 2376 WP_002885146.1 endopeptidase La -
  BLD38_RS06355 (BLD38_06355) - 1182075..1182722 (-) 648 WP_012006727.1 outer membrane protein assembly factor BamD -
  BLD38_RS06360 (BLD38_06360) fliW 1182883..1183272 (+) 390 WP_002852982.1 flagellar assembly protein FliW -
  BLD38_RS06365 (BLD38_06365) proC 1183272..1184003 (+) 732 WP_002859150.1 pyrroline-5-carboxylate reductase Machinery gene
  BLD38_RS06370 (BLD38_06370) ctsT 1184000..1184188 (+) 189 WP_195182296.1 hypothetical protein Machinery gene
  BLD38_RS06375 (BLD38_06375) - 1184286..1184948 (+) 663 WP_002859149.1 hypothetical protein -
  BLD38_RS06380 (BLD38_06380) - 1184945..1185397 (+) 453 WP_002859148.1 hypothetical protein -
  BLD38_RS06385 (BLD38_06385) hemD 1185394..1186023 (-) 630 WP_002859147.1 uroporphyrinogen-III synthase -
  BLD38_RS06390 (BLD38_06390) thiE 1186001..1186633 (-) 633 WP_002852670.1 thiamine phosphate synthase -
  BLD38_RS06395 (BLD38_06395) thiD 1186623..1187435 (-) 813 WP_002885404.1 bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase -
  BLD38_RS06400 (BLD38_06400) - 1187432..1188118 (-) 687 WP_002852847.1 endonuclease III domain-containing protein -
  BLD38_RS06405 (BLD38_06405) - 1188115..1188876 (-) 762 WP_002852748.1 ATP-binding protein -

Sequence


Protein


Download         Length: 62 a.a.        Molecular weight: 7586.08 Da        Isoelectric Point: 8.3159

>NTDB_id=203315 BLD38_RS06370 WP_195182296.1 1184000..1184188(+) (ctsT) [Campylobacter jejuni strain FJ3124]
MKKAFILIESISAITIISLIFIGIFYYYIQLYKNYENLNIFERLYKLQEELYEKPIFIKLQP

Nucleotide


Download         Length: 189 bp        

>NTDB_id=203315 BLD38_RS06370 WP_195182296.1 1184000..1184188(+) (ctsT) [Campylobacter jejuni strain FJ3124]
ATGAAAAAGGCTTTCATACTTATAGAAAGCATTAGTGCTATAACGATCATATCTTTAATTTTCATTGGCATTTTTTATTA
CTATATTCAACTTTACAAAAACTATGAAAATTTAAATATTTTTGAAAGACTCTATAAACTTCAAGAAGAATTATATGAAA
AGCCTATTTTTATCAAACTTCAGCCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ctsT Campylobacter jejuni subsp. jejuni 81-176

98.246

91.935

0.903


Multiple sequence alignment