Detailed information
Bioinformatically predicted
Overview
| Name | Cj0683 | Type | Machinery gene |
| Locus tag | BLD38_RS02735 | Genome accession | NZ_CP017862 |
| Coordinates | 480618..481055 (+) | Length | 145 a.a. |
| NCBI ID | WP_002852324.1 | Uniprot ID | A0AA44HIV8 |
| Organism | Campylobacter jejuni strain FJ3124 | ||
| Function | initialization of DNA uptake (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 444737..480005 | 480618..481055 | flank | 613 |
Gene organization within MGE regions
Location: 444737..481055
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BLD38_RS09420 | - | 444785..445009 (+) | 225 | WP_251815778.1 | hypothetical protein | - |
| BLD38_RS02460 (BLD38_02460) | - | 445147..445776 (+) | 630 | WP_071319651.1 | S24 family peptidase | - |
| BLD38_RS02465 (BLD38_02465) | - | 445857..446177 (+) | 321 | WP_002865000.1 | hypothetical protein | - |
| BLD38_RS02470 (BLD38_02470) | - | 446187..446381 (+) | 195 | WP_002843339.1 | hypothetical protein | - |
| BLD38_RS02475 (BLD38_02475) | - | 446461..446748 (+) | 288 | WP_032593226.1 | hypothetical protein | - |
| BLD38_RS02480 (BLD38_02480) | - | 446776..447591 (-) | 816 | WP_039333509.1 | DNA adenine methylase | - |
| BLD38_RS02485 (BLD38_02485) | - | 447693..448661 (-) | 969 | WP_002870152.1 | phage tail protein | - |
| BLD38_RS02490 (BLD38_02490) | - | 448655..448846 (-) | 192 | WP_002789964.1 | tail protein X | - |
| BLD38_RS02495 (BLD38_02495) | - | 448839..449213 (-) | 375 | WP_002870151.1 | phage tail protein | - |
| BLD38_RS02500 (BLD38_02500) | - | 449215..451179 (-) | 1965 | WP_002870150.1 | phage tail tape measure protein | - |
| BLD38_RS02505 (BLD38_02505) | - | 451209..451439 (+) | 231 | WP_002870149.1 | hypothetical protein | - |
| BLD38_RS02510 (BLD38_02510) | - | 451547..451783 (-) | 237 | WP_002789979.1 | phage tail assembly protein | - |
| BLD38_RS02515 (BLD38_02515) | - | 451794..452309 (-) | 516 | WP_002865794.1 | phage major tail tube protein | - |
| BLD38_RS02520 (BLD38_02520) | - | 452432..453622 (-) | 1191 | WP_071319652.1 | phage tail sheath family protein | - |
| BLD38_RS02525 (BLD38_02525) | - | 453641..454648 (-) | 1008 | WP_039332504.1 | hypothetical protein | - |
| BLD38_RS02530 (BLD38_02530) | - | 454772..455143 (-) | 372 | WP_002938257.1 | DUF1353 domain-containing protein | - |
| BLD38_RS02535 (BLD38_02535) | - | 455140..455646 (-) | 507 | WP_039332508.1 | DUF4376 domain-containing protein | - |
| BLD38_RS02540 (BLD38_02540) | - | 455671..456702 (-) | 1032 | WP_039332511.1 | phage tail protein | - |
| BLD38_RS02545 (BLD38_02545) | - | 456702..457322 (-) | 621 | WP_039332513.1 | phage tail protein I | - |
| BLD38_RS02550 (BLD38_02550) | - | 457319..458485 (-) | 1167 | WP_057041530.1 | baseplate J/gp47 family protein | - |
| BLD38_RS02555 (BLD38_02555) | - | 458482..458772 (-) | 291 | WP_002795239.1 | GPW/gp25 family protein | - |
| BLD38_RS02560 (BLD38_02560) | - | 458769..458960 (-) | 192 | WP_002795238.1 | hypothetical protein | - |
| BLD38_RS02565 (BLD38_02565) | - | 458969..459601 (-) | 633 | WP_032584244.1 | phage baseplate assembly protein V | - |
| BLD38_RS02570 (BLD38_02570) | - | 459598..460062 (-) | 465 | WP_002865847.1 | DUF1804 family protein | - |
| BLD38_RS02575 (BLD38_02575) | - | 460193..461233 (+) | 1041 | WP_002790001.1 | phage protease | - |
| BLD38_RS02580 (BLD38_02580) | - | 461233..462120 (+) | 888 | WP_002790002.1 | Mu-like prophage major head subunit gpT family protein | - |
| BLD38_RS02585 (BLD38_02585) | - | 462120..462389 (+) | 270 | WP_019108985.1 | hypothetical protein | - |
| BLD38_RS02590 (BLD38_02590) | - | 462386..462739 (+) | 354 | WP_002790896.1 | hypothetical protein | - |
| BLD38_RS02595 (BLD38_02595) | - | 462736..463101 (+) | 366 | WP_002790266.1 | hypothetical protein | - |
| BLD38_RS02600 (BLD38_02600) | - | 463091..463480 (+) | 390 | WP_002878913.1 | D-Ala-D-Ala carboxypeptidase family metallohydrolase | - |
| BLD38_RS02605 (BLD38_02605) | - | 463491..463832 (+) | 342 | WP_002854893.1 | hypothetical protein | - |
| BLD38_RS02610 (BLD38_02610) | - | 463829..464077 (+) | 249 | WP_002784496.1 | hypothetical protein | - |
| BLD38_RS02615 (BLD38_02615) | - | 464189..464503 (+) | 315 | WP_071319653.1 | phage holin family protein | - |
| BLD38_RS02620 (BLD38_02620) | terL | 464593..466119 (+) | 1527 | WP_002865465.1 | phage terminase large subunit | - |
| BLD38_RS02625 (BLD38_02625) | - | 466116..467498 (+) | 1383 | WP_002870186.1 | DUF935 family protein | - |
| BLD38_RS02630 (BLD38_02630) | - | 467491..468624 (+) | 1134 | WP_002870187.1 | phage minor head protein | - |
| BLD38_RS02635 (BLD38_02635) | - | 468763..469242 (-) | 480 | WP_002913855.1 | phage virion morphogenesis protein | - |
| BLD38_RS02640 (BLD38_02640) | - | 469229..469420 (-) | 192 | WP_002790256.1 | hypothetical protein | - |
| BLD38_RS02645 (BLD38_02645) | - | 469472..469900 (-) | 429 | WP_002790255.1 | hypothetical protein | - |
| BLD38_RS02650 (BLD38_02650) | - | 469897..470076 (-) | 180 | WP_002864977.1 | hypothetical protein | - |
| BLD38_RS02655 (BLD38_02655) | - | 470190..470597 (-) | 408 | WP_052797554.1 | YopX family protein | - |
| BLD38_RS02660 (BLD38_02660) | - | 470608..471039 (-) | 432 | WP_002938698.1 | hypothetical protein | - |
| BLD38_RS02665 (BLD38_02665) | - | 471036..471308 (-) | 273 | WP_071319654.1 | hypothetical protein | - |
| BLD38_RS02670 (BLD38_02670) | - | 471380..471865 (-) | 486 | WP_071319655.1 | host-nuclease inhibitor Gam family protein | - |
| BLD38_RS02680 (BLD38_02680) | - | 472061..472399 (-) | 339 | WP_002865074.1 | DUF4406 domain-containing protein | - |
| BLD38_RS02685 (BLD38_02685) | - | 472473..472904 (-) | 432 | WP_002865075.1 | SA1788 family PVL leukocidin-associated protein | - |
| BLD38_RS02690 (BLD38_02690) | - | 472960..473145 (-) | 186 | WP_002824157.1 | hypothetical protein | - |
| BLD38_RS02695 (BLD38_02695) | - | 473142..473333 (-) | 192 | WP_002795448.1 | sigma factor-like helix-turn-helix DNA-binding protein | - |
| BLD38_RS02700 (BLD38_02700) | - | 473330..474187 (-) | 858 | WP_002790751.1 | AAA family ATPase | - |
| BLD38_RS02705 (BLD38_02705) | - | 474275..476389 (-) | 2115 | WP_071319656.1 | Mu transposase C-terminal domain-containing protein | - |
| BLD38_RS02710 (BLD38_02710) | - | 476390..476590 (-) | 201 | WP_002790505.1 | hypothetical protein | - |
| BLD38_RS02715 (BLD38_02715) | - | 476871..477560 (+) | 690 | WP_071319657.1 | XRE family transcriptional regulator | - |
| BLD38_RS09425 | - | 477779..477919 (+) | 141 | WP_251815777.1 | hypothetical protein | - |
| BLD38_RS09520 | - | 477906..478037 (+) | 132 | WP_256379349.1 | hypothetical protein | - |
| BLD38_RS02720 (BLD38_02720) | uvrB | 478032..480005 (-) | 1974 | WP_002884660.1 | excinuclease ABC subunit UvrB | - |
| BLD38_RS02725 (BLD38_02725) | - | 480159..480389 (+) | 231 | WP_002852327.1 | hypothetical protein | - |
| BLD38_RS02730 (BLD38_02730) | - | 480379..480621 (+) | 243 | WP_002854947.1 | hypothetical protein | - |
| BLD38_RS02735 (BLD38_02735) | Cj0683 | 480618..481055 (+) | 438 | WP_002852324.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | Machinery gene |
Sequence
Protein
Download Length: 145 a.a. Molecular weight: 16765.76 Da Isoelectric Point: 8.0993
>NTDB_id=203310 BLD38_RS02735 WP_002852324.1 480618..481055(+) (Cj0683) [Campylobacter jejuni strain FJ3124]
MNKAFTLLELVFVILILGILSSLSLSFINTTKDEVKILKLKMDYEMLSSALALMRSQMRLKNLNFPEILDNAQNNQAKEK
LFYCLNDCDYSLLDTPIYSDFKSWIKIGKNHYRFALNAKEMVEFIYDSKEGLLKCIGSSRCKDLI
MNKAFTLLELVFVILILGILSSLSLSFINTTKDEVKILKLKMDYEMLSSALALMRSQMRLKNLNFPEILDNAQNNQAKEK
LFYCLNDCDYSLLDTPIYSDFKSWIKIGKNHYRFALNAKEMVEFIYDSKEGLLKCIGSSRCKDLI
Nucleotide
Download Length: 438 bp
>NTDB_id=203310 BLD38_RS02735 WP_002852324.1 480618..481055(+) (Cj0683) [Campylobacter jejuni strain FJ3124]
ATGAATAAAGCTTTTACTCTGCTTGAGCTTGTTTTTGTGATTTTGATTTTGGGAATTTTGTCAAGCTTATCTTTATCTTT
TATCAATACTACAAAAGATGAGGTTAAAATTTTAAAATTAAAAATGGACTATGAAATGCTAAGCTCAGCTCTTGCTTTAA
TGCGTAGTCAAATGAGACTTAAAAATTTAAATTTTCCAGAAATTTTAGATAATGCGCAAAACAATCAAGCCAAAGAAAAA
CTCTTTTATTGTTTAAATGATTGTGATTATTCTTTGCTTGATACACCTATTTATTCTGATTTTAAATCTTGGATAAAAAT
AGGTAAAAATCACTATAGATTTGCATTAAATGCTAAAGAGATGGTTGAATTTATTTATGATTCTAAAGAAGGTTTGTTAA
AGTGTATAGGAAGTTCTAGATGCAAAGATCTGATATAA
ATGAATAAAGCTTTTACTCTGCTTGAGCTTGTTTTTGTGATTTTGATTTTGGGAATTTTGTCAAGCTTATCTTTATCTTT
TATCAATACTACAAAAGATGAGGTTAAAATTTTAAAATTAAAAATGGACTATGAAATGCTAAGCTCAGCTCTTGCTTTAA
TGCGTAGTCAAATGAGACTTAAAAATTTAAATTTTCCAGAAATTTTAGATAATGCGCAAAACAATCAAGCCAAAGAAAAA
CTCTTTTATTGTTTAAATGATTGTGATTATTCTTTGCTTGATACACCTATTTATTCTGATTTTAAATCTTGGATAAAAAT
AGGTAAAAATCACTATAGATTTGCATTAAATGCTAAAGAGATGGTTGAATTTATTTATGATTCTAAAGAAGGTTTGTTAA
AGTGTATAGGAAGTTCTAGATGCAAAGATCTGATATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| Cj0683 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
100 |
100 |
1 |