Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | BKP58_RS21010 | Genome accession | NZ_CP017763 |
| Coordinates | 3936326..3936736 (+) | Length | 136 a.a. |
| NCBI ID | WP_009967785.1 | Uniprot ID | A0A6I4D881 |
| Organism | Bacillus subtilis strain 29R7-12 | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3913440..3953026 | 3936326..3936736 | within | 0 |
Gene organization within MGE regions
Location: 3913440..3953026
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BKP58_RS20860 (BKP58_20815) | - | 3913440..3913620 (+) | 181 | Protein_4042 | hypothetical protein | - |
| BKP58_RS23405 | - | 3913929..3914159 (+) | 231 | WP_224588644.1 | hypothetical protein | - |
| BKP58_RS20870 | - | 3914304..3914552 (+) | 249 | Protein_4044 | hypothetical protein | - |
| BKP58_RS20875 | - | 3914515..3914637 (+) | 123 | Protein_4045 | RusA family crossover junction endodeoxyribonuclease | - |
| BKP58_RS20880 (BKP58_20825) | - | 3914720..3914872 (+) | 153 | WP_049832653.1 | XtrA/YqaO family protein | - |
| BKP58_RS20885 (BKP58_20830) | - | 3915011..3915277 (-) | 267 | WP_033881358.1 | hypothetical protein | - |
| BKP58_RS20890 (BKP58_20835) | - | 3915894..3916373 (+) | 480 | WP_014480344.1 | hypothetical protein | - |
| BKP58_RS22855 | - | 3916766..3917071 (-) | 306 | WP_123772463.1 | hypothetical protein | - |
| BKP58_RS23040 (BKP58_20840) | terS | 3917198..3917762 (+) | 565 | Protein_4050 | phage terminase small subunit | - |
| BKP58_RS20900 (BKP58_20845) | - | 3917722..3918197 (+) | 476 | Protein_4051 | phage tail tube protein | - |
| BKP58_RS20905 | - | 3918484..3918570 (-) | 87 | WP_072592549.1 | putative holin-like toxin | - |
| BKP58_RS23655 (BKP58_20850) | - | 3918745..3918911 (+) | 167 | Protein_4053 | peptidoglycan-binding domain-containing protein | - |
| BKP58_RS20915 (BKP58_20855) | istB | 3919163..3919921 (-) | 759 | WP_014479891.1 | IS21-like element helper ATPase IstB | - |
| BKP58_RS20920 (BKP58_20860) | istA | 3919918..3921465 (-) | 1548 | WP_014480339.1 | IS21 family transposase | - |
| BKP58_RS20930 (BKP58_20870) | - | 3922306..3922596 (-) | 291 | WP_014480337.1 | contact-dependent growth inhibition system immunity protein | - |
| BKP58_RS20935 (BKP58_20875) | atxG | 3922706..3923283 (-) | 578 | Protein_4057 | suppressor of fused domain protein | - |
| BKP58_RS20940 (BKP58_20880) | - | 3923551..3923784 (-) | 234 | WP_224588641.1 | hypothetical protein | - |
| BKP58_RS22865 | - | 3923873..3924076 (+) | 204 | WP_123772462.1 | hypothetical protein | - |
| BKP58_RS20945 (BKP58_20885) | - | 3924384..3924896 (-) | 513 | WP_014477426.1 | hypothetical protein | - |
| BKP58_RS20950 (BKP58_20890) | cdiI | 3924968..3925327 (-) | 360 | WP_014480334.1 | ribonuclease toxin immunity protein CdiI | - |
| BKP58_RS20955 (BKP58_20895) | - | 3925424..3925876 (-) | 453 | WP_014480333.1 | SMI1/KNR4 family protein | - |
| BKP58_RS20960 (BKP58_20900) | - | 3925975..3926415 (-) | 441 | WP_014480332.1 | SMI1/KNR4 family protein | - |
| BKP58_RS20965 (BKP58_20905) | - | 3926818..3927105 (-) | 288 | WP_014480331.1 | hypothetical protein | - |
| BKP58_RS23660 | - | 3927119..3927826 (-) | 708 | WP_014480330.1 | hypothetical protein | - |
| BKP58_RS23665 (BKP58_20915) | - | 3928212..3929045 (-) | 834 | Protein_4066 | ribonuclease YeeF family protein | - |
| BKP58_RS20975 (BKP58_20920) | - | 3929227..3930354 (+) | 1128 | WP_014480328.1 | Rap family tetratricopeptide repeat protein | - |
| BKP58_RS20985 (BKP58_20925) | - | 3931094..3931489 (-) | 396 | WP_014480327.1 | VOC family protein | - |
| BKP58_RS20990 (BKP58_20930) | - | 3932431..3933321 (-) | 891 | WP_014480326.1 | LysR family transcriptional regulator | - |
| BKP58_RS20995 (BKP58_20935) | fumC | 3933488..3934876 (+) | 1389 | WP_014480325.1 | class II fumarate hydratase | - |
| BKP58_RS23435 | - | 3935095..3935307 (+) | 213 | Protein_4071 | recombinase family protein | - |
| BKP58_RS22875 (BKP58_20945) | - | 3935304..3935402 (-) | 99 | WP_031600702.1 | hypothetical protein | - |
| BKP58_RS21005 (BKP58_20950) | sigK | 3935402..3936130 (-) | 729 | WP_013308023.1 | RNA polymerase sporulation sigma factor SigK | - |
| BKP58_RS21010 (BKP58_20955) | nucA/comI | 3936326..3936736 (+) | 411 | WP_009967785.1 | sporulation-specific Dnase NucB | Machinery gene |
| BKP58_RS21015 (BKP58_20960) | yqeB | 3936769..3937491 (-) | 723 | WP_014480321.1 | hypothetical protein | - |
| BKP58_RS21020 (BKP58_20965) | gnd | 3937742..3938635 (+) | 894 | WP_014480320.1 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
| BKP58_RS21025 (BKP58_20970) | yqeD | 3938654..3939280 (-) | 627 | WP_014480319.1 | TVP38/TMEM64 family protein | - |
| BKP58_RS21030 (BKP58_20975) | cwlH | 3939467..3940219 (+) | 753 | WP_014480318.1 | N-acetylmuramoyl-L-alanine amidase CwlH | - |
| BKP58_RS21035 (BKP58_20980) | yqeF | 3940471..3941202 (+) | 732 | WP_003229964.1 | SGNH/GDSL hydrolase family protein | - |
| BKP58_RS21040 (BKP58_20990) | - | 3941508..3941648 (-) | 141 | WP_003226124.1 | sporulation histidine kinase inhibitor Sda | - |
| BKP58_RS21045 (BKP58_20995) | yqeG | 3942010..3942528 (+) | 519 | WP_003226126.1 | YqeG family HAD IIIA-type phosphatase | - |
| BKP58_RS21050 (BKP58_21000) | yqeH | 3942532..3943632 (+) | 1101 | WP_003229966.1 | ribosome biogenesis GTPase YqeH | - |
| BKP58_RS21055 (BKP58_21005) | aroE | 3943650..3944492 (+) | 843 | WP_014480317.1 | shikimate dehydrogenase | - |
| BKP58_RS21060 (BKP58_21010) | yhbY | 3944486..3944776 (+) | 291 | WP_003226133.1 | ribosome assembly RNA-binding protein YhbY | - |
| BKP58_RS21065 (BKP58_21015) | nadD | 3944788..3945357 (+) | 570 | WP_004398676.1 | nicotinate-nucleotide adenylyltransferase | - |
| BKP58_RS21070 (BKP58_21020) | yqeK | 3945347..3945907 (+) | 561 | WP_014480316.1 | bis(5'-nucleosyl)-tetraphosphatase (symmetrical) YqeK | - |
| BKP58_RS21075 (BKP58_21025) | rsfS | 3945925..3946281 (+) | 357 | WP_014480315.1 | ribosome silencing factor | - |
| BKP58_RS21080 (BKP58_21030) | yqeM | 3946278..3947021 (+) | 744 | WP_014480314.1 | class I SAM-dependent DNA methyltransferase | - |
| BKP58_RS21085 (BKP58_21035) | comER | 3947087..3947908 (-) | 822 | WP_014480313.1 | late competence protein ComER | - |
| BKP58_RS21090 (BKP58_21040) | comEA | 3947992..3948609 (+) | 618 | WP_014480312.1 | competence protein ComEA | Machinery gene |
| BKP58_RS21095 (BKP58_21045) | comEB | 3948676..3949245 (+) | 570 | WP_003229978.1 | ComE operon protein 2 | - |
| BKP58_RS21100 (BKP58_21050) | comEC | 3949249..3951579 (+) | 2331 | WP_033881047.1 | DNA internalization-related competence protein ComEC/Rec2 | Machinery gene |
| BKP58_RS21105 (BKP58_21055) | yqzM | 3951619..3951753 (-) | 135 | WP_003229983.1 | YqzM family protein | - |
| BKP58_RS22880 | - | 3951794..3951943 (+) | 150 | WP_003229985.1 | hypothetical protein | - |
| BKP58_RS21110 (BKP58_21060) | holA | 3951983..3953026 (+) | 1044 | WP_014480310.1 | DNA polymerase III subunit delta | - |
Sequence
Protein
Download Length: 136 a.a. Molecular weight: 14967.97 Da Isoelectric Point: 5.1853
>NTDB_id=202699 BKP58_RS21010 WP_009967785.1 3936326..3936736(+) (nucA/comI) [Bacillus subtilis strain 29R7-12]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
Nucleotide
Download Length: 411 bp
>NTDB_id=202699 BKP58_RS21010 WP_009967785.1 3936326..3936736(+) (nucA/comI) [Bacillus subtilis strain 29R7-12]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
62.609 |
84.559 |
0.529 |