Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BI197_RS14120 Genome accession   NZ_CP017747
Coordinates   2933173..2933313 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain SYBC H47     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2928173..2938313
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BI197_RS14095 - 2928513..2928896 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  BI197_RS14100 comA 2928918..2929562 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  BI197_RS14105 comP 2929643..2931934 (-) 2292 WP_039254056.1 histidine kinase Regulator
  BI197_RS14110 comX 2931946..2932110 (-) 165 WP_007613432.1 competence pheromone ComX -
  BI197_RS14115 - 2932110..2933021 (-) 912 WP_031378407.1 polyprenyl synthetase family protein -
  BI197_RS14120 degQ 2933173..2933313 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  BI197_RS14125 - 2933779..2934120 (+) 342 WP_014305721.1 hypothetical protein -
  BI197_RS14130 - 2934127..2935347 (-) 1221 WP_039254052.1 EAL and HDOD domain-containing protein -
  BI197_RS14135 - 2935477..2936943 (-) 1467 WP_099686880.1 nicotinate phosphoribosyltransferase -
  BI197_RS14140 - 2936961..2937512 (-) 552 WP_025853916.1 cysteine hydrolase family protein -
  BI197_RS14145 - 2937609..2938007 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=202472 BI197_RS14120 WP_003152043.1 2933173..2933313(-) (degQ) [Bacillus velezensis strain SYBC H47]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=202472 BI197_RS14120 WP_003152043.1 2933173..2933313(-) (degQ) [Bacillus velezensis strain SYBC H47]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment