Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   BI197_RS11955 Genome accession   NZ_CP017747
Coordinates   2476202..2476321 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain SYBC H47     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 2471202..2481321
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BI197_RS11935 - 2471441..2472199 (-) 759 WP_071392129.1 ABC transporter ATP-binding protein -
  BI197_RS11940 - 2472193..2473140 (-) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  BI197_RS11945 ceuB 2473130..2474083 (-) 954 WP_003156332.1 ABC transporter permease Machinery gene
  BI197_RS11950 - 2474498..2475862 (+) 1365 WP_071392130.1 aspartate kinase -
  BI197_RS19070 - 2475942..2476052 (+) 111 WP_369719092.1 YjcZ family sporulation protein -
  BI197_RS11955 phrC 2476202..2476321 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  BI197_RS11960 rapC 2476305..2477453 (-) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  BI197_RS11965 - 2477606..2479039 (-) 1434 WP_187297950.1 sensor histidine kinase -
  BI197_RS11970 - 2479026..2479709 (-) 684 WP_014416901.1 response regulator transcription factor -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=202463 BI197_RS11955 WP_003156334.1 2476202..2476321(-) (phrC) [Bacillus velezensis strain SYBC H47]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=202463 BI197_RS11955 WP_003156334.1 2476202..2476321(-) (phrC) [Bacillus velezensis strain SYBC H47]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718

Multiple sequence alignment