Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   CG450_RS09155 Genome accession   NZ_CP022477
Coordinates   1742069..1742245 (-) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   Q65HF5
Organism   Bacillus licheniformis strain BL-010     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 1737069..1747245
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CG450_RS09110 comGE 1737404..1737751 (+) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -
  CG450_RS09115 comGF 1737777..1738148 (+) 372 WP_003183461.1 competence type IV pilus minor pilin ComGF Machinery gene
  CG450_RS09120 comGG 1738161..1738526 (+) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  CG450_RS09125 - 1738615..1738797 (+) 183 WP_003183456.1 YqzE family protein -
  CG450_RS09130 - 1738821..1739141 (-) 321 WP_003183454.1 YqzG/YhdC family protein -
  CG450_RS09135 tapA 1739418..1740146 (+) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  CG450_RS09140 sipW 1740143..1740727 (+) 585 WP_003183449.1 signal peptidase I SipW -
  CG450_RS09145 tasA 1740801..1741595 (+) 795 WP_003183447.1 biofilm matrix protein TasA -
  CG450_RS09150 sinR 1741700..1742035 (-) 336 WP_025804940.1 transcriptional regulator SinR Regulator
  CG450_RS09155 sinI 1742069..1742245 (-) 177 WP_003183444.1 anti-repressor SinI Regulator
  CG450_RS09160 - 1742436..1743230 (-) 795 WP_003183441.1 YqhG family protein -
  CG450_RS09165 - 1743237..1744916 (-) 1680 WP_003183439.1 DEAD/DEAH box helicase -
  CG450_RS09170 gcvT 1745509..1746603 (+) 1095 WP_003183436.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=200981 CG450_RS09155 WP_003183444.1 1742069..1742245(-) (sinI) [Bacillus licheniformis strain BL-010]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=200981 CG450_RS09155 WP_003183444.1 1742069..1742245(-) (sinI) [Bacillus licheniformis strain BL-010]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q65HF5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517


Multiple sequence alignment