Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | BJG91_RS09070 | Genome accession | NZ_CP017577 |
| Coordinates | 1336482..1336760 (+) | Length | 92 a.a. |
| NCBI ID | WP_000799091.1 | Uniprot ID | - |
| Organism | Bacillus thuringiensis strain SCG04-02 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1327639..1367534 | 1336482..1336760 | within | 0 |
Gene organization within MGE regions
Location: 1327639..1367534
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BJG91_RS09010 (BJG91_08730) | - | 1327639..1327902 (+) | 264 | WP_002082716.1 | DUF3937 domain-containing protein | - |
| BJG91_RS09015 (BJG91_08735) | - | 1328461..1328781 (+) | 321 | WP_065212708.1 | heterocycloanthracin/sonorensin family bacteriocin | - |
| BJG91_RS31390 | - | 1328931..1329065 (+) | 135 | Protein_1326 | site-specific integrase | - |
| BJG91_RS09020 (BJG91_08740) | - | 1329275..1329760 (+) | 486 | WP_002041181.1 | hypothetical protein | - |
| BJG91_RS09025 (BJG91_08745) | - | 1330072..1330773 (+) | 702 | WP_065212707.1 | DUF3962 domain-containing protein | - |
| BJG91_RS09030 (BJG91_08750) | - | 1330812..1331921 (-) | 1110 | WP_065212706.1 | tyrosine-type recombinase/integrase | - |
| BJG91_RS09035 (BJG91_08755) | - | 1332467..1333618 (+) | 1152 | WP_065212705.1 | AimR family lysis-lysogeny pheromone receptor | - |
| BJG91_RS09040 (BJG91_08760) | - | 1333656..1333802 (+) | 147 | WP_000720921.1 | hypothetical protein | - |
| BJG91_RS32035 | - | 1333957..1334085 (+) | 129 | WP_000836783.1 | hypothetical protein | - |
| BJG91_RS09045 (BJG91_08765) | - | 1334123..1334476 (-) | 354 | WP_065212704.1 | helix-turn-helix transcriptional regulator | - |
| BJG91_RS09050 (BJG91_08770) | - | 1334677..1334868 (+) | 192 | WP_000854271.1 | helix-turn-helix transcriptional regulator | - |
| BJG91_RS09055 (BJG91_08775) | - | 1334923..1335189 (+) | 267 | WP_000522030.1 | helix-turn-helix domain-containing protein | - |
| BJG91_RS31395 (BJG91_08780) | - | 1335189..1335353 (+) | 165 | WP_069461647.1 | hypothetical protein | - |
| BJG91_RS09065 (BJG91_08785) | - | 1335411..1336478 (+) | 1068 | WP_065212703.1 | DnaD domain protein | - |
| BJG91_RS09070 (BJG91_08790) | abrB | 1336482..1336760 (+) | 279 | WP_000799091.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| BJG91_RS09075 (BJG91_08795) | - | 1336753..1337112 (+) | 360 | WP_065212702.1 | cell division protein SepF | - |
| BJG91_RS09080 (BJG91_08800) | - | 1337132..1337299 (+) | 168 | WP_065212701.1 | DUF3954 domain-containing protein | - |
| BJG91_RS09085 (BJG91_08805) | - | 1337325..1337576 (+) | 252 | WP_065212700.1 | hypothetical protein | - |
| BJG91_RS09090 (BJG91_08810) | - | 1337597..1338079 (+) | 483 | WP_065212699.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| BJG91_RS09095 (BJG91_08815) | - | 1338462..1338656 (-) | 195 | WP_065212698.1 | hypothetical protein | - |
| BJG91_RS09100 (BJG91_08820) | - | 1339670..1340839 (+) | 1170 | WP_065212697.1 | hypothetical protein | - |
| BJG91_RS09110 (BJG91_08830) | - | 1341289..1341975 (-) | 687 | WP_065212696.1 | CPBP family glutamic-type intramembrane protease | - |
| BJG91_RS09115 (BJG91_08835) | - | 1342596..1343225 (+) | 630 | WP_065212695.1 | hypothetical protein | - |
| BJG91_RS31400 (BJG91_08840) | - | 1343384..1343554 (+) | 171 | WP_069461646.1 | hypothetical protein | - |
| BJG91_RS09125 (BJG91_08845) | - | 1343582..1344064 (+) | 483 | WP_065212694.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| BJG91_RS09130 (BJG91_08850) | - | 1344064..1344606 (+) | 543 | WP_065212693.1 | site-specific integrase | - |
| BJG91_RS09135 (BJG91_08855) | - | 1344820..1345770 (+) | 951 | WP_065212692.1 | nucleoside hydrolase | - |
| BJG91_RS09140 (BJG91_08860) | - | 1346147..1347154 (+) | 1008 | WP_081283940.1 | hypothetical protein | - |
| BJG91_RS09150 (BJG91_08865) | - | 1347515..1347724 (+) | 210 | WP_061113368.1 | hypothetical protein | - |
| BJG91_RS09155 (BJG91_08870) | - | 1347863..1348117 (+) | 255 | WP_065212691.1 | hypothetical protein | - |
| BJG91_RS09160 (BJG91_08875) | - | 1348107..1348484 (+) | 378 | WP_065212690.1 | HNH endonuclease | - |
| BJG91_RS09165 (BJG91_08880) | - | 1348612..1349115 (+) | 504 | WP_000251640.1 | phage terminase small subunit P27 family | - |
| BJG91_RS09170 (BJG91_08885) | - | 1349117..1350811 (+) | 1695 | WP_065212689.1 | terminase TerL endonuclease subunit | - |
| BJG91_RS09175 (BJG91_08890) | - | 1351000..1352253 (+) | 1254 | WP_065212688.1 | phage portal protein | - |
| BJG91_RS09180 (BJG91_08895) | - | 1352240..1352950 (+) | 711 | WP_065212687.1 | head maturation protease, ClpP-related | - |
| BJG91_RS09185 (BJG91_08900) | - | 1352988..1354160 (+) | 1173 | WP_065212686.1 | phage major capsid protein | - |
| BJG91_RS09190 (BJG91_08905) | - | 1354181..1354468 (+) | 288 | WP_065212685.1 | head-tail connector protein | - |
| BJG91_RS09195 (BJG91_08910) | - | 1354455..1354778 (+) | 324 | WP_065212684.1 | phage head closure protein | - |
| BJG91_RS09200 (BJG91_08915) | - | 1354771..1355205 (+) | 435 | WP_060851857.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| BJG91_RS09205 (BJG91_08920) | - | 1355202..1355561 (+) | 360 | WP_065212683.1 | DUF3168 domain-containing protein | - |
| BJG91_RS09210 (BJG91_08925) | - | 1355562..1356167 (+) | 606 | WP_000896776.1 | major tail protein | - |
| BJG91_RS09215 (BJG91_08930) | - | 1356217..1356534 (+) | 318 | WP_000779162.1 | hypothetical protein | - |
| BJG91_RS31105 | - | 1356564..1356740 (+) | 177 | WP_000344056.1 | hypothetical protein | - |
| BJG91_RS09220 (BJG91_08935) | - | 1356756..1360607 (+) | 3852 | WP_065212682.1 | phage tail tape measure protein | - |
| BJG91_RS09225 (BJG91_08940) | - | 1360622..1362103 (+) | 1482 | WP_081283938.1 | distal tail protein Dit | - |
| BJG91_RS09230 (BJG91_08945) | - | 1362100..1366137 (+) | 4038 | WP_065212681.1 | phage tail spike protein | - |
| BJG91_RS09235 (BJG91_08950) | - | 1366177..1366602 (+) | 426 | WP_065212680.1 | phage holin family protein | - |
| BJG91_RS09240 (BJG91_08955) | - | 1366602..1367534 (+) | 933 | WP_065212679.1 | N-acetylmuramoyl-L-alanine amidase | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10113.74 Da Isoelectric Point: 5.7189
>NTDB_id=200495 BJG91_RS09070 WP_000799091.1 1336482..1336760(+) (abrB) [Bacillus thuringiensis strain SCG04-02]
MKNTGVARKVDELGRVVIPVELRRTLGIVEGTALDFHVDGENIVLRKYEKSCFVTGEVSETNIELLGGRMFLSKEGAIEL
LDLIQKSGMAHA
MKNTGVARKVDELGRVVIPVELRRTLGIVEGTALDFHVDGENIVLRKYEKSCFVTGEVSETNIELLGGRMFLSKEGAIEL
LDLIQKSGMAHA
Nucleotide
Download Length: 279 bp
>NTDB_id=200495 BJG91_RS09070 WP_000799091.1 1336482..1336760(+) (abrB) [Bacillus thuringiensis strain SCG04-02]
ATGAAAAACACAGGCGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACCTTAGG
TATTGTCGAAGGTACGGCACTAGATTTTCATGTCGATGGGGAAAACATTGTTCTAAGAAAATATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA
ATGAAAAACACAGGCGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACCTTAGG
TATTGTCGAAGGTACGGCACTAGATTTTCATGTCGATGGGGAAAACATTGTTCTAAGAAAATATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
60.92 |
94.565 |
0.576 |