Detailed information    

insolico Bioinformatically predicted

Overview

Name   comE/blpR   Type   Regulator
Locus tag   CFA72_RS10245 Genome accession   NZ_CP022206
Coordinates   1508706..1508924 (-) Length   72 a.a.
NCBI ID   WP_072135532.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain GURSA1     
Function   activate transcription of early competence genes; regulation of comX expression (predicted from homology)   
Competence regulation

Genomic Context

Location: 1503706..1513924
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CFA72_RS07905 (CFA72_07910) - 1504417..1504734 (-) 318 WP_002994587.1 hypothetical protein -
  CFA72_RS07910 (CFA72_07915) - 1504783..1505010 (-) 228 WP_028797129.1 Blp family class II bacteriocin -
  CFA72_RS10235 - 1505408..1505536 (-) 129 WP_002994583.1 hypothetical protein -
  CFA72_RS10400 (CFA72_07920) - 1505621..1505932 (-) 312 WP_225793061.1 CPBP family intramembrane glutamic endopeptidase -
  CFA72_RS10070 - 1506227..1506403 (-) 177 WP_002994581.1 hypothetical protein -
  CFA72_RS07920 (CFA72_07925) - 1506381..1506605 (-) 225 WP_002994580.1 Blp family class II bacteriocin -
  CFA72_RS10240 - 1506903..1508509 (+) 1607 Protein_1493 ABC transporter transmembrane domain-containing protein -
  CFA72_RS10245 comE/blpR 1508706..1508924 (-) 219 WP_072135532.1 LytTR family transcriptional regulator DNA-binding domain-containing protein Regulator
  CFA72_RS10250 (CFA72_07945) - 1509225..1509479 (+) 255 WP_014407373.1 hypothetical protein -
  CFA72_RS07945 (CFA72_07950) - 1509785..1510261 (-) 477 WP_093974809.1 NUDIX hydrolase -
  CFA72_RS07950 (CFA72_07955) era 1510281..1511177 (-) 897 WP_002985743.1 GTPase Era -
  CFA72_RS07955 (CFA72_07960) - 1511297..1511704 (-) 408 WP_002985746.1 diacylglycerol kinase family protein -
  CFA72_RS07960 (CFA72_07965) ybeY 1511685..1512182 (-) 498 WP_032467023.1 rRNA maturation RNase YbeY -
  CFA72_RS07965 (CFA72_07970) - 1512341..1512916 (-) 576 WP_009880369.1 uracil-DNA glycosylase family protein -

Sequence

Protein


Download         Length: 72 a.a.        Molecular weight: 8666.13 Da        Isoelectric Point: 10.5045

>NTDB_id=199788 CFA72_RS10245 WP_072135532.1 1508706..1508924(-) (comE/blpR) [Streptococcus pyogenes strain GURSA1]
MVLYSTRERIEFYGELSEIVKQEPRLFQCHRSFVVNPYNISSIQRLERKVYLKKRFILSSIKAKSYCSKRSS

Nucleotide


Download         Length: 219 bp        

>NTDB_id=199788 CFA72_RS10245 WP_072135532.1 1508706..1508924(-) (comE/blpR) [Streptococcus pyogenes strain GURSA1]
TTGGTTCTTTATTCTACTAGAGAAAGGATTGAATTTTATGGGGAGTTATCTGAAATCGTTAAGCAAGAACCAAGATTATT
TCAATGCCATCGATCATTTGTTGTTAATCCCTACAATATATCTTCAATACAACGATTAGAACGTAAGGTTTATTTAAAAA
AACGGTTCATCTTGTCTAGTATCAAGGCTAAAAGTTACTGCTCTAAAAGAAGCAGTTGA

Domains

Predicted by InterProScan.

LytTr DNA-binding domain (LytTR)

(3-55)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE/blpR Streptococcus mutans UA159

56.604

73.611

0.417

Multiple sequence alignment