Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   CFA72_RS00675 Genome accession   NZ_CP022206
Coordinates   104537..104821 (+) Length   94 a.a.
NCBI ID   WP_011284422.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain GURSA1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 99537..109821
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CFA72_RS00650 (CFA72_00650) - 101468..101833 (+) 366 WP_002986560.1 DUF1033 family protein -
  CFA72_RS00655 (CFA72_00655) comGA 101926..102879 (+) 954 WP_030126921.1 competence type IV pilus ATPase ComGA Machinery gene
  CFA72_RS00660 (CFA72_00660) comGB 102815..103849 (+) 1035 WP_225793059.1 competence type IV pilus assembly protein ComGB Machinery gene
  CFA72_RS00665 (CFA72_00665) comGC 103851..104177 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  CFA72_RS00670 (CFA72_00670) comGD 104152..104580 (+) 429 WP_023605232.1 competence type IV pilus minor pilin ComGD Machinery gene
  CFA72_RS00675 (CFA72_00675) comGE 104537..104821 (+) 285 WP_011284422.1 competence type IV pilus minor pilin ComGE Machinery gene
  CFA72_RS00680 (CFA72_00680) comGF 104814..105248 (+) 435 WP_002992738.1 competence type IV pilus minor pilin ComGF Machinery gene
  CFA72_RS00685 (CFA72_00685) comGG 105232..105558 (+) 327 WP_002992739.1 competence type IV pilus minor pilin ComGG -
  CFA72_RS00690 (CFA72_00690) comGH 105656..106609 (+) 954 WP_023610092.1 class I SAM-dependent methyltransferase Machinery gene
  CFA72_RS00695 (CFA72_00695) - 106668..107864 (+) 1197 WP_002992742.1 acetate kinase -
  CFA72_RS00700 (CFA72_00700) - 108051..108359 (+) 309 WP_032467031.1 hypothetical protein -
  CFA72_RS00705 (CFA72_00705) proC 108442..109212 (-) 771 WP_002992745.1 pyrroline-5-carboxylate reductase -

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10654.59 Da        Isoelectric Point: 8.9043

>NTDB_id=199698 CFA72_RS00675 WP_011284422.1 104537..104821(+) (comGE) [Streptococcus pyogenes strain GURSA1]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEITLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=199698 CFA72_RS00675 WP_011284422.1 104537..104821(+) (comGE) [Streptococcus pyogenes strain GURSA1]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATTGCAACAGGCATCCTCTTTAGTATTGT
CATTCTTGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATAACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA

Domains

Predicted by InterProScan.

Type II secretory pathway pseudopilin (ComGE)

(12-93)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383

Multiple sequence alignment