Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   BSBS38_RS15960 Genome accession   NZ_CP017314
Coordinates   2989081..2989221 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain BS38     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2984081..2994221
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSBS38_RS15935 (BSBS38_03207) yuxO 2984358..2984738 (-) 381 WP_069837723.1 hotdog fold thioesterase -
  BSBS38_RS15940 (BSBS38_03208) comA 2984757..2985401 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  BSBS38_RS15945 (BSBS38_03209) comP 2985482..2987794 (-) 2313 WP_069964288.1 sensor histidine kinase Regulator
  BSBS38_RS15950 (BSBS38_03210) comX 2987810..2988031 (-) 222 WP_014480704.1 competence pheromone ComX -
  BSBS38_RS15955 (BSBS38_03211) - 2988033..2988896 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  BSBS38_RS15960 (BSBS38_03212) degQ 2989081..2989221 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  BSBS38_RS22060 (BSBS38_03213) - 2989443..2989568 (+) 126 WP_003228793.1 hypothetical protein -
  BSBS38_RS15965 (BSBS38_03214) - 2989683..2990051 (+) 369 WP_046381300.1 hypothetical protein -
  BSBS38_RS15970 (BSBS38_03215) pdeH 2990027..2991256 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  BSBS38_RS15975 (BSBS38_03216) pncB 2991392..2992864 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  BSBS38_RS15980 (BSBS38_03217) pncA 2992880..2993431 (-) 552 WP_014480709.1 cysteine hydrolase family protein -
  BSBS38_RS15985 (BSBS38_03218) yueI 2993528..2993926 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=197647 BSBS38_RS15960 WP_003220708.1 2989081..2989221(-) (degQ) [Bacillus subtilis strain BS38]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=197647 BSBS38_RS15960 WP_003220708.1 2989081..2989221(-) (degQ) [Bacillus subtilis strain BS38]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment