Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | BSBS38_RS13155 | Genome accession | NZ_CP017314 |
| Coordinates | 2450537..2450947 (-) | Length | 136 a.a. |
| NCBI ID | WP_009967785.1 | Uniprot ID | A0A6I4D881 |
| Organism | Bacillus subtilis strain BS38 | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2445903..2480665 | 2450537..2450947 | within | 0 |
Gene organization within MGE regions
Location: 2445903..2480665
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSBS38_RS13130 (BSBS38_02644) | yqeF | 2446070..2446801 (-) | 732 | WP_003229964.1 | SGNH/GDSL hydrolase family protein | - |
| BSBS38_RS13135 (BSBS38_02645) | cwlH | 2447053..2447805 (-) | 753 | WP_069964218.1 | N-acetylmuramoyl-L-alanine amidase CwlH | - |
| BSBS38_RS13140 (BSBS38_02646) | yqeD | 2447992..2448618 (+) | 627 | WP_014480319.1 | TVP38/TMEM64 family protein | - |
| BSBS38_RS13145 | gnd | 2448638..2449530 (-) | 893 | Protein_2534 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
| BSBS38_RS13150 (BSBS38_02649) | yqeB | 2449782..2450504 (+) | 723 | WP_014480321.1 | hypothetical protein | - |
| BSBS38_RS13155 (BSBS38_02650) | nucA/comI | 2450537..2450947 (-) | 411 | WP_009967785.1 | sporulation-specific Dnase NucB | Machinery gene |
| BSBS38_RS22560 | sigK | 2451143..2451870 (+) | 728 | Protein_2537 | RNA polymerase sporulation sigma factor SigK | - |
| BSBS38_RS21975 | - | 2451870..2451968 (+) | 99 | WP_031600702.1 | hypothetical protein | - |
| BSBS38_RS22415 | - | 2451965..2452177 (-) | 213 | Protein_2539 | recombinase family protein | - |
| BSBS38_RS13175 (BSBS38_02653) | fumC | 2452396..2453784 (-) | 1389 | WP_014480325.1 | class II fumarate hydratase | - |
| BSBS38_RS13180 (BSBS38_02654) | - | 2453951..2454841 (+) | 891 | WP_014480326.1 | LysR family transcriptional regulator | - |
| BSBS38_RS13185 (BSBS38_02655) | - | 2455782..2456177 (+) | 396 | WP_046160622.1 | VOC family protein | - |
| BSBS38_RS13190 (BSBS38_02657) | - | 2456917..2458044 (-) | 1128 | WP_014480328.1 | Rap family tetratricopeptide repeat protein | - |
| BSBS38_RS22705 | - | 2458226..2459059 (+) | 834 | Protein_2544 | ribonuclease YeeF family protein | - |
| BSBS38_RS22710 (BSBS38_02660) | - | 2459445..2460152 (+) | 708 | WP_014480330.1 | hypothetical protein | - |
| BSBS38_RS13205 (BSBS38_02661) | - | 2460166..2460453 (+) | 288 | WP_014480331.1 | hypothetical protein | - |
| BSBS38_RS13210 (BSBS38_02662) | - | 2460856..2461296 (+) | 441 | WP_014480332.1 | SMI1/KNR4 family protein | - |
| BSBS38_RS22565 (BSBS38_02663) | - | 2461395..2461622 (+) | 228 | WP_250637576.1 | SMI1/KNR4 family protein | - |
| BSBS38_RS22570 | - | 2461636..2461848 (+) | 213 | WP_268284630.1 | SMI1/KNR4 family protein | - |
| BSBS38_RS13220 (BSBS38_02664) | cdiI | 2461945..2462304 (+) | 360 | WP_014480334.1 | ribonuclease toxin immunity protein CdiI | - |
| BSBS38_RS13225 (BSBS38_02665) | - | 2462409..2462888 (+) | 480 | WP_224588637.1 | hypothetical protein | - |
| BSBS38_RS13230 (BSBS38_02667) | istA | 2463334..2464881 (+) | 1548 | WP_014480339.1 | IS21 family transposase | - |
| BSBS38_RS13235 (BSBS38_02668) | istB | 2464878..2465636 (+) | 759 | WP_014479891.1 | IS21-like element helper ATPase IstB | - |
| BSBS38_RS13240 (BSBS38_02670) | - | 2465972..2466205 (+) | 234 | WP_224588641.1 | hypothetical protein | - |
| BSBS38_RS13245 | atxG | 2466473..2467050 (+) | 578 | Protein_2555 | suppressor of fused domain protein | - |
| BSBS38_RS13250 (BSBS38_02672) | - | 2467160..2467450 (+) | 291 | WP_014480337.1 | contact-dependent growth inhibition system immunity protein | - |
| BSBS38_RS22715 (BSBS38_02673) | - | 2468359..2468525 (-) | 167 | Protein_2557 | peptidoglycan-binding domain-containing protein | - |
| BSBS38_RS21615 | - | 2468700..2468786 (+) | 87 | WP_072592549.1 | putative holin-like toxin | - |
| BSBS38_RS22720 (BSBS38_02674) | - | 2469073..2469548 (-) | 476 | Protein_2559 | phage tail tube protein | - |
| BSBS38_RS22190 | terS | 2469508..2470072 (-) | 565 | Protein_2560 | phage terminase small subunit | - |
| BSBS38_RS21990 | - | 2470199..2470504 (+) | 306 | WP_123772463.1 | hypothetical protein | - |
| BSBS38_RS13275 (BSBS38_02676) | - | 2470897..2471286 (-) | 390 | WP_069964219.1 | hypothetical protein | - |
| BSBS38_RS13280 (BSBS38_02678) | - | 2471992..2472258 (+) | 267 | WP_033881358.1 | hypothetical protein | - |
| BSBS38_RS13285 | - | 2472397..2472549 (-) | 153 | WP_049832653.1 | XtrA/YqaO family protein | - |
| BSBS38_RS21620 | - | 2472632..2472754 (-) | 123 | Protein_2565 | RusA family crossover junction endodeoxyribonuclease | - |
| BSBS38_RS21625 | - | 2472717..2472965 (-) | 249 | Protein_2566 | hypothetical protein | - |
| BSBS38_RS22455 | - | 2473110..2473340 (-) | 231 | WP_224588644.1 | hypothetical protein | - |
| BSBS38_RS13295 (BSBS38_02680) | - | 2473649..2473829 (-) | 181 | Protein_2568 | hypothetical protein | - |
| BSBS38_RS13300 (BSBS38_02681) | bltR | 2474037..2474858 (-) | 822 | WP_014480349.1 | multidrug efflux transcriptional regulator BltR | - |
| BSBS38_RS13305 (BSBS38_02682) | blt | 2474975..2476177 (+) | 1203 | WP_029727180.1 | multidrug efflux MFS transporter Blt | - |
| BSBS38_RS13310 (BSBS38_02683) | bltD | 2476346..2476804 (+) | 459 | WP_015714357.1 | spermine/spermidine acetyltransferase | - |
| BSBS38_RS13315 (BSBS38_02684) | yrkA | 2476953..2478257 (-) | 1305 | WP_019712547.1 | hemolysin family protein | - |
| BSBS38_RS13320 (BSBS38_02685) | yrzO | 2478547..2478690 (-) | 144 | WP_014477437.1 | YrzO family protein | - |
| BSBS38_RS13325 (BSBS38_02686) | yrdR | 2478708..2479673 (-) | 966 | WP_014480354.1 | DMT family transporter | - |
| BSBS38_RS13330 (BSBS38_02687) | czcR | 2479799..2480665 (+) | 867 | WP_014480355.1 | LysR family transcriptional regulator CzcR | - |
Sequence
Protein
Download Length: 136 a.a. Molecular weight: 14967.97 Da Isoelectric Point: 5.1853
>NTDB_id=197636 BSBS38_RS13155 WP_009967785.1 2450537..2450947(-) (nucA/comI) [Bacillus subtilis strain BS38]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
Nucleotide
Download Length: 411 bp
>NTDB_id=197636 BSBS38_RS13155 WP_009967785.1 2450537..2450947(-) (nucA/comI) [Bacillus subtilis strain BS38]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
62.609 |
84.559 |
0.529 |