Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   A4W88_RS06870 Genome accession   NZ_CP017275
Coordinates   1329352..1329657 (-) Length   101 a.a.
NCBI ID   WP_025016385.1    Uniprot ID   A0AAX0VCA2
Organism   Latilactobacillus sakei strain TMW 1.1398     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1324352..1334657
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A4W88_RS06835 (A4W88_06775) - 1324791..1325156 (+) 366 WP_076632064.1 DUF805 domain-containing protein -
  A4W88_RS06845 (A4W88_06785) - 1325699..1326157 (-) 459 WP_011374992.1 hypothetical protein -
  A4W88_RS06850 (A4W88_06790) - 1326212..1327408 (-) 1197 WP_011374993.1 acetate kinase -
  A4W88_RS06855 (A4W88_06795) - 1327430..1328440 (-) 1011 WP_011374994.1 class I SAM-dependent methyltransferase -
  A4W88_RS06860 (A4W88_06800) - 1328564..1328902 (-) 339 WP_011374995.1 hypothetical protein -
  A4W88_RS06865 (A4W88_06805) comGF 1328865..1329377 (-) 513 WP_041820873.1 competence type IV pilus minor pilin ComGF Machinery gene
  A4W88_RS06870 (A4W88_06810) comGE 1329352..1329657 (-) 306 WP_025016385.1 hypothetical protein Machinery gene
  A4W88_RS06875 (A4W88_06815) comGD 1329644..1330096 (-) 453 WP_076632063.1 competence type IV pilus minor pilin ComGD Machinery gene
  A4W88_RS06880 (A4W88_06820) comGC 1330068..1330367 (-) 300 WP_076632062.1 prepilin-type N-terminal cleavage/methylation domain-containing protein Machinery gene
  A4W88_RS06885 (A4W88_06825) comGB 1330364..1330876 (-) 513 WP_251930849.1 type II secretion system F family protein Machinery gene
  A4W88_RS06890 (A4W88_06830) comGB 1331002..1331370 (-) 369 WP_251930850.1 type II secretion system F family protein Machinery gene
  A4W88_RS06895 (A4W88_06835) comGA 1331363..1332253 (-) 891 WP_076632060.1 competence type IV pilus ATPase ComGA Machinery gene
  A4W88_RS06900 (A4W88_06840) - 1332369..1333100 (-) 732 WP_076632059.1 YebC/PmpR family DNA-binding transcriptional regulator -
  A4W88_RS06905 (A4W88_06845) - 1333191..1333691 (-) 501 WP_076632058.1 VanZ family protein -
  A4W88_RS06910 (A4W88_06850) - 1333788..1334177 (+) 390 WP_076632056.1 hypothetical protein -

Sequence

Protein


Download         Length: 101 a.a.        Molecular weight: 11451.47 Da        Isoelectric Point: 11.1577

>NTDB_id=197270 A4W88_RS06870 WP_025016385.1 1329352..1329657(-) (comGE) [Latilactobacillus sakei strain TMW 1.1398]
MFRSRPAFLLVENIIALTLVLGACWLLTVSLLHFKQQQTLKQQQVAQQAVLAMAAEQLRAHQTVKKRWQMGRTIYTVTAN
QQKLKVTTKAGESVAINWTTD

Nucleotide


Download         Length: 306 bp        

>NTDB_id=197270 A4W88_RS06870 WP_025016385.1 1329352..1329657(-) (comGE) [Latilactobacillus sakei strain TMW 1.1398]
ATGTTCAGAAGTAGGCCGGCTTTTTTACTCGTTGAAAATATCATCGCCTTAACCTTAGTATTAGGGGCTTGCTGGCTATT
AACGGTAAGTCTACTACACTTTAAGCAACAACAAACGCTTAAACAACAGCAAGTTGCACAACAGGCGGTTCTAGCAATGG
CTGCTGAGCAGTTGAGAGCGCATCAGACAGTGAAAAAACGGTGGCAAATGGGGCGAACAATCTATACAGTGACGGCTAAT
CAGCAGAAATTAAAGGTAACCACAAAGGCAGGTGAGTCGGTTGCGATTAATTGGACGACCGATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Latilactobacillus sakei subsp. sakei 23K

99.01

100

0.99

Multiple sequence alignment