Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   BHU02_RS06855 Genome accession   NZ_CP017271
Coordinates   1345218..1345517 (-) Length   99 a.a.
NCBI ID   WP_025016383.1    Uniprot ID   A0A9N7P7J9
Organism   Latilactobacillus sakei subsp. sakei strain TMW 1.1189     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1340218..1350517
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BHU02_RS06820 (BHU02_06705) - 1340850..1341308 (-) 459 WP_025016390.1 hypothetical protein -
  BHU02_RS06825 (BHU02_06710) - 1341363..1342558 (-) 1196 Protein_1310 acetate kinase -
  BHU02_RS06830 (BHU02_06715) - 1342580..1343590 (-) 1011 WP_025016388.1 class I SAM-dependent methyltransferase -
  BHU02_RS06835 (BHU02_06720) - 1343714..1344052 (-) 339 WP_025016387.1 hypothetical protein -
  BHU02_RS06840 (BHU02_06725) comGF 1344015..1344527 (-) 513 WP_025016386.1 competence type IV pilus minor pilin ComGF Machinery gene
  BHU02_RS06845 (BHU02_06730) comGE 1344502..1344807 (-) 306 WP_025016385.1 hypothetical protein Machinery gene
  BHU02_RS06850 (BHU02_06735) comGD 1344794..1345246 (-) 453 WP_025016384.1 competence type IV pilus minor pilin ComGD Machinery gene
  BHU02_RS06855 (BHU02_06740) comGC 1345218..1345517 (-) 300 WP_025016383.1 prepilin-type N-terminal cleavage/methylation domain-containing protein Machinery gene
  BHU02_RS06860 (BHU02_06745) comGB 1345514..1346521 (-) 1008 WP_056936423.1 type II secretion system F family protein Machinery gene
  BHU02_RS06865 (BHU02_06750) comGA 1346514..1347404 (-) 891 WP_025016380.1 competence type IV pilus ATPase ComGA Machinery gene
  BHU02_RS06870 (BHU02_06755) - 1347521..1348252 (-) 732 WP_011375002.1 YebC/PmpR family DNA-binding transcriptional regulator -
  BHU02_RS06875 (BHU02_06760) - 1348343..1348843 (-) 501 WP_016265379.1 VanZ family protein -
  BHU02_RS06880 (BHU02_06765) - 1348940..1349314 (+) 375 WP_011375004.1 hypothetical protein -

Sequence


Protein


Download         Length: 99 a.a.        Molecular weight: 11067.03 Da        Isoelectric Point: 10.1321

>NTDB_id=197161 BHU02_RS06855 WP_025016383.1 1345218..1345517(-) (comGC) [Latilactobacillus sakei subsp. sakei strain TMW 1.1189]
MKKKRNAFTLIEMVIVLAIVALLILLISPNLVAQKQRAEKKTDQALVTTLQTQVELAADEQGHQIKSLDELTDKYISKDQ
LKHAKEKGITIDSGTVKQK

Nucleotide


Download         Length: 300 bp        

>NTDB_id=197161 BHU02_RS06855 WP_025016383.1 1345218..1345517(-) (comGC) [Latilactobacillus sakei subsp. sakei strain TMW 1.1189]
ATGAAGAAAAAAAGAAATGCTTTTACATTAATCGAAATGGTAATTGTTCTAGCAATTGTGGCGTTGTTAATTTTATTAAT
CTCACCAAATTTGGTGGCTCAAAAACAGCGCGCGGAGAAGAAAACCGATCAAGCTTTAGTGACGACTTTACAAACGCAAG
TTGAATTGGCTGCCGATGAACAAGGTCATCAAATTAAGAGTCTAGATGAATTAACGGATAAGTATATTTCAAAAGACCAA
TTAAAGCACGCAAAGGAGAAGGGGATTACAATTGATAGCGGCACGGTTAAGCAAAAATGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Latilactobacillus sakei subsp. sakei 23K

89.899

100

0.899


Multiple sequence alignment