Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGB   Type   Machinery gene
Locus tag   LCW_RS03350 Genome accession   NZ_CP017124
Coordinates   657425..658426 (+) Length   333 a.a.
NCBI ID   WP_069468028.1    Uniprot ID   -
Organism   Latilactobacillus curvatus strain WiKim38     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 658479..705440 657425..658426 flank 53


Gene organization within MGE regions


Location: 657425..705440
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LCW_RS03350 (LCW_03350) comGB 657425..658426 (+) 1002 WP_069468028.1 type II secretion system F family protein Machinery gene
  LCW_RS03355 (LCW_03355) - 658479..659903 (-) 1425 WP_069468029.1 recombinase family protein -
  LCW_RS03360 (LCW_03360) - 660012..660713 (-) 702 WP_069468030.1 hypothetical protein -
  LCW_RS03365 (LCW_03365) - 660706..661128 (-) 423 WP_069468031.1 hypothetical protein -
  LCW_RS03370 (LCW_03370) - 661121..662029 (-) 909 WP_069468032.1 ParA family protein -
  LCW_RS03375 (LCW_03375) - 662129..663115 (-) 987 WP_069468033.1 DUF4236 domain-containing protein -
  LCW_RS03380 (LCW_03380) - 663252..663881 (-) 630 WP_143435696.1 hypothetical protein -
  LCW_RS03385 (LCW_03385) - 663989..664834 (-) 846 WP_069468034.1 hypothetical protein -
  LCW_RS03390 (LCW_03390) - 664894..665295 (-) 402 WP_069468035.1 ImmA/IrrE family metallo-endopeptidase -
  LCW_RS03395 (LCW_03395) - 665295..665630 (-) 336 WP_069468036.1 helix-turn-helix domain-containing protein -
  LCW_RS03400 (LCW_03400) - 665779..666006 (+) 228 WP_069468037.1 helix-turn-helix domain-containing protein -
  LCW_RS10080 - 666025..666189 (+) 165 WP_155760082.1 hypothetical protein -
  LCW_RS03405 (LCW_03405) - 666249..666800 (+) 552 WP_237023253.1 helix-turn-helix domain-containing protein -
  LCW_RS10505 - 666797..666949 (+) 153 WP_186738769.1 BOW99_gp33 family protein -
  LCW_RS03415 (LCW_03415) - 667241..667438 (+) 198 WP_069468039.1 hypothetical protein -
  LCW_RS03420 (LCW_03420) bet 667438..668205 (+) 768 WP_069468040.1 phage recombination protein Bet -
  LCW_RS03425 (LCW_03425) - 668087..668956 (+) 870 WP_237023254.1 PD-(D/E)XK nuclease-like domain-containing protein -
  LCW_RS03430 (LCW_03430) ssb 668968..669384 (+) 417 WP_069468042.1 single-stranded DNA-binding protein Machinery gene
  LCW_RS03435 (LCW_03435) - 669395..670360 (+) 966 WP_069468043.1 DnaD domain-containing protein -
  LCW_RS03445 (LCW_03445) - 670560..671090 (+) 531 WP_069468045.1 helix-turn-helix domain-containing protein -
  LCW_RS03450 (LCW_03450) - 671062..671268 (+) 207 WP_081303843.1 DUF6877 family protein -
  LCW_RS10085 - 671268..671429 (+) 162 WP_155760086.1 hypothetical protein -
  LCW_RS03455 (LCW_03455) - 671429..671884 (+) 456 WP_081326636.1 class I SAM-dependent methyltransferase -
  LCW_RS03460 (LCW_03460) - 671955..672242 (+) 288 WP_069468047.1 hypothetical protein -
  LCW_RS10090 - 672256..672426 (+) 171 WP_155760088.1 hypothetical protein -
  LCW_RS03465 (LCW_03465) - 672460..672798 (+) 339 WP_065825501.1 hypothetical protein -
  LCW_RS03470 (LCW_03470) - 672809..673156 (+) 348 WP_069468048.1 YopX family protein -
  LCW_RS10455 - 673156..673284 (+) 129 WP_257784602.1 hypothetical protein -
  LCW_RS03475 (LCW_03475) - 673284..673748 (+) 465 WP_039098605.1 DUF1064 domain-containing protein -
  LCW_RS03480 (LCW_03480) - 673760..673963 (+) 204 WP_065825503.1 hypothetical protein -
  LCW_RS03485 (LCW_03485) - 673983..674165 (+) 183 WP_065825504.1 hypothetical protein -
  LCW_RS03490 (LCW_03490) - 674165..674401 (+) 237 WP_039098607.1 helix-turn-helix domain-containing protein -
  LCW_RS03495 (LCW_03495) - 674515..674940 (+) 426 WP_065825505.1 ArpU family phage packaging/lysis transcriptional regulator -
  LCW_RS03500 (LCW_03500) - 675434..676339 (+) 906 WP_069468049.1 hypothetical protein -
  LCW_RS10095 - 676583..676753 (+) 171 WP_155760091.1 hypothetical protein -
  LCW_RS03505 (LCW_03505) - 676753..677577 (+) 825 WP_069468050.1 terminase small subunit -
  LCW_RS03510 (LCW_03510) - 677570..678844 (+) 1275 WP_069468051.1 PBSX family phage terminase large subunit -
  LCW_RS03515 (LCW_03515) - 678855..680303 (+) 1449 WP_069468052.1 phage portal protein -
  LCW_RS03520 (LCW_03520) - 680245..680559 (+) 315 WP_069468053.1 ribosomal-processing cysteine protease Prp -
  LCW_RS03525 (LCW_03525) - 680562..681755 (+) 1194 WP_069468054.1 minor capsid protein -
  LCW_RS03530 (LCW_03530) - 681924..682568 (+) 645 WP_069468055.1 capsid assembly scaffolding protein Gp46 family protein -
  LCW_RS03535 (LCW_03535) - 682581..682937 (+) 357 WP_069468056.1 hypothetical protein -
  LCW_RS03540 (LCW_03540) - 682960..684021 (+) 1062 WP_039098617.1 major capsid protein -
  LCW_RS03545 (LCW_03545) - 684036..684356 (+) 321 WP_155760093.1 phage head-tail connector protein -
  LCW_RS03550 (LCW_03550) - 684422..684742 (+) 321 WP_237023255.1 hypothetical protein -
  LCW_RS03555 (LCW_03555) - 684690..685235 (+) 546 WP_069468058.1 hypothetical protein -
  LCW_RS03560 (LCW_03560) - 685237..685602 (+) 366 WP_069468539.1 hypothetical protein -
  LCW_RS03565 (LCW_03565) - 685615..686079 (+) 465 WP_069468059.1 phage tail tube protein -
  LCW_RS09935 - 686136..686327 (+) 192 Protein_693 Ig-like domain-containing protein -
  LCW_RS03570 (LCW_03570) - 686351..686755 (+) 405 WP_069468060.1 DUF6096 family protein -
  LCW_RS03575 (LCW_03575) - 686776..687156 (+) 381 WP_081326601.1 hypothetical protein -
  LCW_RS03580 (LCW_03580) - 687168..691985 (+) 4818 WP_069468061.1 hypothetical protein -
  LCW_RS03585 (LCW_03585) - 692001..692360 (+) 360 WP_069468062.1 DUF6711 family protein -
  LCW_RS03590 (LCW_03590) - 692372..696373 (+) 4002 WP_069468063.1 gp58-like family protein -
  LCW_RS03595 (LCW_03595) - 696370..696816 (+) 447 WP_069468064.1 DUF1617 family protein -
  LCW_RS03600 (LCW_03600) - 696816..697043 (+) 228 WP_069468065.1 hypothetical protein -
  LCW_RS03605 (LCW_03605) - 697062..697535 (+) 474 WP_081326602.1 phage holin family protein -
  LCW_RS03610 (LCW_03610) - 697532..697810 (+) 279 WP_069468066.1 phage holin family protein -
  LCW_RS03615 (LCW_03615) - 697810..698616 (+) 807 WP_069468067.1 N-acetylmuramoyl-L-alanine amidase -
  LCW_RS03620 (LCW_03620) - 698658..699734 (-) 1077 WP_069468068.1 AbiH family protein -
  LCW_RS03625 (LCW_03625) - 699849..700109 (+) 261 WP_069468069.1 hypothetical protein -
  LCW_RS03630 (LCW_03630) - 700139..700420 (+) 282 WP_069468070.1 hypothetical protein -
  LCW_RS03635 (LCW_03635) - 700471..700662 (-) 192 WP_069468071.1 helix-turn-helix domain-containing protein -
  LCW_RS03640 (LCW_03640) - 700676..701068 (-) 393 WP_069468072.1 hypothetical protein -
  LCW_RS03645 (LCW_03645) - 701174..701629 (-) 456 WP_069468073.1 hypothetical protein -
  LCW_RS03650 (LCW_03650) - 701632..701892 (-) 261 WP_069468074.1 hypothetical protein -
  LCW_RS10100 - 701911..702084 (-) 174 WP_155760095.1 hypothetical protein -
  LCW_RS03655 (LCW_03655) - 702110..702511 (-) 402 WP_069468075.1 homing endonuclease associated repeat-containing protein -
  LCW_RS03660 (LCW_03660) - 702592..702837 (+) 246 WP_237023256.1 competence protein ComGC -
  LCW_RS03665 (LCW_03665) - 702869..703261 (+) 393 WP_069468076.1 hypothetical protein -
  LCW_RS10225 (LCW_03670) - 703326..703553 (+) 228 WP_158070299.1 hypothetical protein -
  LCW_RS10510 - 703519..703602 (+) 84 Protein_716 type II secretion system protein -
  LCW_RS03675 (LCW_03675) - 703624..704004 (+) 381 WP_004270914.1 ComGF family competence protein -
  LCW_RS03680 (LCW_03680) - 703982..704305 (+) 324 WP_039099486.1 hypothetical protein -
  LCW_RS03685 (LCW_03685) - 704421..705440 (+) 1020 WP_335617917.1 class I SAM-dependent methyltransferase -

Sequence


Protein


Download         Length: 333 a.a.        Molecular weight: 37831.02 Da        Isoelectric Point: 9.6278

>NTDB_id=195893 LCW_RS03350 WP_069468028.1 657425..658426(+) (comGB) [Latilactobacillus curvatus strain WiKim38]
MKTKTTVQFNTEFMLLLGRLLQNGFSLQQALEFMPIVFPTQKQWLHQVQTGLEAGKRLGPSLAAVSFPTHLVAQIELTEL
QGNLGECLLHLGQLQRIQQKRRRELVGVIAYPCFLLLFLGALIGMMQIYLFPEIAQFNPTTSATSPLQLFFRVMGTFVIM
AGGLISVYLFRWHRRPLLQRLAAAFRWPFIGKTLQAYYQYCLLFDLATCLNNGLNLAEMHQLTHRLAKTSWLVQLMQQLE
TAVQKGGTLLANLADGVFYPPELQLVLAKGGPLQQMAKEVDLLAVIKYDELQRQLKQKVNWLQPLLFILIGIIIICTYLS
ILLPLYHTMEGIS

Nucleotide


Download         Length: 1002 bp        

>NTDB_id=195893 LCW_RS03350 WP_069468028.1 657425..658426(+) (comGB) [Latilactobacillus curvatus strain WiKim38]
ATGAAGACTAAAACCACTGTTCAATTCAATACTGAATTTATGTTGCTGTTAGGGCGCTTACTGCAAAATGGTTTTTCTTT
ACAACAAGCACTTGAGTTCATGCCGATTGTTTTTCCGACACAAAAGCAGTGGCTGCATCAGGTGCAAACTGGGTTAGAAG
CAGGAAAACGACTAGGACCAAGCTTAGCGGCGGTTTCGTTTCCAACACACCTTGTTGCACAGATTGAATTGACTGAGTTG
CAGGGAAACTTAGGCGAGTGTTTGTTACATCTTGGCCAATTACAGCGAATTCAACAGAAACGGCGTAGAGAGTTAGTTGG
CGTAATTGCCTATCCCTGTTTTCTACTCCTTTTTCTCGGGGCGTTGATTGGGATGATGCAGATTTATCTTTTTCCGGAAA
TCGCGCAGTTTAACCCAACAACTTCGGCGACATCACCATTACAACTATTTTTTAGAGTGATGGGGACATTCGTTATTATG
GCTGGTGGTCTGATTAGTGTGTATTTATTCCGTTGGCATCGGCGACCGCTATTACAACGATTGGCGGCGGCATTTAGATG
GCCGTTCATCGGTAAAACGTTGCAGGCTTACTATCAGTATTGCTTATTATTTGATTTAGCGACTTGCCTGAATAACGGCT
TAAACTTGGCCGAAATGCATCAGCTTACACATCGTTTGGCGAAAACATCGTGGCTTGTACAATTAATGCAACAACTTGAA
ACGGCTGTCCAAAAGGGGGGCACGCTATTAGCGAACTTAGCGGATGGCGTTTTTTATCCACCTGAGCTGCAATTAGTGCT
CGCTAAGGGAGGTCCATTACAACAGATGGCCAAGGAGGTTGATCTGCTTGCAGTCATTAAATACGATGAACTGCAACGGC
AATTGAAACAGAAGGTGAATTGGCTACAACCGCTCTTGTTTATCCTAATTGGGATCATCATTATTTGTACCTATCTCAGT
ATTTTATTACCGCTATATCATACAATGGAGGGAATTTCATGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGB Latilactobacillus sakei subsp. sakei 23K

56.973

100

0.577


Multiple sequence alignment