Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | FORC47_RS13095 | Genome accession | NZ_CP017060 |
| Coordinates | 2514283..2514561 (+) | Length | 92 a.a. |
| NCBI ID | WP_089171094.1 | Uniprot ID | - |
| Organism | Bacillus cereus strain FORC_047 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2495103..2552047 | 2514283..2514561 | within | 0 |
Gene organization within MGE regions
Location: 2495103..2552047
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FORC47_RS12980 (FORC47_2419) | - | 2495103..2495873 (+) | 771 | WP_053564410.1 | ABC transporter ATP-binding protein | - |
| FORC47_RS12985 (FORC47_2420) | - | 2495848..2497782 (+) | 1935 | WP_089171082.1 | ABC transporter permease | - |
| FORC47_RS12990 (FORC47_2421) | - | 2497850..2498521 (+) | 672 | WP_157676090.1 | lipoprotein BA_5634 family protein | - |
| FORC47_RS12995 (FORC47_2422) | - | 2498630..2498971 (-) | 342 | WP_071730528.1 | DUF3914 domain-containing protein | - |
| FORC47_RS13000 (FORC47_2423) | - | 2499252..2500493 (+) | 1242 | WP_089171084.1 | esterase/lipase family protein | - |
| FORC47_RS13005 (FORC47_2424) | - | 2500581..2501606 (+) | 1026 | WP_089171085.1 | homoserine dehydrogenase | - |
| FORC47_RS13010 (FORC47_2425) | - | 2501696..2503144 (+) | 1449 | WP_089171086.1 | PLP-dependent aminotransferase family protein | - |
| FORC47_RS13015 (FORC47_2426) | - | 2503149..2504063 (+) | 915 | WP_061660682.1 | D-alanine--D-alanine ligase | - |
| FORC47_RS13020 (FORC47_2427) | tenA | 2504370..2505059 (+) | 690 | WP_075719332.1 | thiaminase II | - |
| FORC47_RS13030 (FORC47_2428) | - | 2505460..2505723 (+) | 264 | WP_089171087.1 | DUF3937 family protein | - |
| FORC47_RS13035 (FORC47_2429) | - | 2506272..2506601 (+) | 330 | WP_048564718.1 | heterocycloanthracin/sonorensin family bacteriocin | - |
| FORC47_RS30585 | - | 2506726..2506875 (+) | 150 | Protein_2421 | site-specific integrase | - |
| FORC47_RS13040 (FORC47_2430) | - | 2507085..2507570 (+) | 486 | WP_002041181.1 | hypothetical protein | - |
| FORC47_RS13045 (FORC47_2431) | - | 2507882..2508583 (+) | 702 | WP_089171088.1 | pPIWI_RE module domain-containing protein | - |
| FORC47_RS13050 (FORC47_2432) | - | 2508622..2509731 (-) | 1110 | WP_089171089.1 | tyrosine-type recombinase/integrase | - |
| FORC47_RS13055 (FORC47_2434) | - | 2510277..2511428 (+) | 1152 | WP_089171090.1 | AimR family lysis-lysogeny pheromone receptor | - |
| FORC47_RS13060 (FORC47_2435) | - | 2511466..2511612 (+) | 147 | WP_000720921.1 | hypothetical protein | - |
| FORC47_RS13065 (FORC47_2436) | - | 2511699..2511896 (+) | 198 | WP_033695148.1 | hypothetical protein | - |
| FORC47_RS13070 (FORC47_2437) | - | 2511934..2512287 (-) | 354 | WP_089171091.1 | helix-turn-helix domain-containing protein | - |
| FORC47_RS13075 (FORC47_2438) | - | 2512488..2512679 (+) | 192 | WP_000854271.1 | helix-turn-helix domain-containing protein | - |
| FORC47_RS13080 (FORC47_2439) | - | 2512735..2513001 (+) | 267 | WP_089171092.1 | helix-turn-helix domain-containing protein | - |
| FORC47_RS30875 (FORC47_2440) | - | 2513001..2513165 (+) | 165 | WP_000390287.1 | hypothetical protein | - |
| FORC47_RS13090 (FORC47_2441) | - | 2513224..2514279 (+) | 1056 | WP_089171093.1 | DnaD domain-containing protein | - |
| FORC47_RS13095 (FORC47_2442) | abrB | 2514283..2514561 (+) | 279 | WP_089171094.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| FORC47_RS13100 (FORC47_2443) | - | 2514554..2514913 (+) | 360 | WP_089171095.1 | cell division protein SepF | - |
| FORC47_RS13105 (FORC47_2444) | - | 2514932..2515099 (+) | 168 | WP_089171096.1 | DUF3954 domain-containing protein | - |
| FORC47_RS13110 (FORC47_2445) | - | 2515130..2515381 (+) | 252 | WP_089171097.1 | helix-turn-helix domain containing protein | - |
| FORC47_RS13115 (FORC47_2446) | - | 2515401..2515856 (+) | 456 | WP_089171098.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| FORC47_RS13120 (FORC47_2448) | - | 2516469..2517002 (+) | 534 | WP_089171099.1 | hypothetical protein | - |
| FORC47_RS13125 (FORC47_2449) | - | 2517029..2517349 (+) | 321 | WP_089172118.1 | hypothetical protein | - |
| FORC47_RS13130 (FORC47_2450) | - | 2517556..2518023 (-) | 468 | WP_089171100.1 | epimerase | - |
| FORC47_RS13135 (FORC47_2451) | - | 2518150..2518368 (+) | 219 | WP_089171101.1 | hypothetical protein | - |
| FORC47_RS13140 | - | 2518531..2518758 (+) | 228 | WP_089171102.1 | hypothetical protein | - |
| FORC47_RS13145 (FORC47_2453) | - | 2518727..2518888 (+) | 162 | WP_089171103.1 | DUF3797 domain-containing protein | - |
| FORC47_RS13150 (FORC47_2454) | - | 2519435..2520208 (-) | 774 | WP_089171104.1 | hypothetical protein | - |
| FORC47_RS13155 (FORC47_2456) | - | 2521129..2521398 (+) | 270 | WP_025709552.1 | hypothetical protein | - |
| FORC47_RS13160 | - | 2521447..2521545 (+) | 99 | WP_089172119.1 | DUF3983 domain-containing protein | - |
| FORC47_RS13165 (FORC47_2457) | - | 2521566..2521754 (+) | 189 | WP_089171105.1 | hypothetical protein | - |
| FORC47_RS30880 (FORC47_2458) | - | 2521853..2522023 (+) | 171 | WP_089171106.1 | hypothetical protein | - |
| FORC47_RS13175 (FORC47_2459) | - | 2522050..2522532 (+) | 483 | WP_063547394.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| FORC47_RS13180 (FORC47_2460) | - | 2522532..2523074 (+) | 543 | WP_053564381.1 | site-specific integrase | - |
| FORC47_RS13185 (FORC47_2461) | - | 2523288..2524238 (+) | 951 | WP_053564380.1 | nucleoside hydrolase | - |
| FORC47_RS13190 (FORC47_2462) | - | 2525048..2526217 (+) | 1170 | WP_016081850.1 | serine hydrolase domain-containing protein | - |
| FORC47_RS13195 (FORC47_2463) | - | 2526560..2526778 (+) | 219 | WP_000930971.1 | hypothetical protein | - |
| FORC47_RS13200 (FORC47_2464) | - | 2527150..2527425 (+) | 276 | WP_000366404.1 | hypothetical protein | - |
| FORC47_RS30885 (FORC47_2465) | - | 2527882..2528049 (+) | 168 | WP_000333210.1 | hypothetical protein | - |
| FORC47_RS13210 (FORC47_2466) | - | 2528042..2528263 (+) | 222 | WP_087967795.1 | hypothetical protein | - |
| FORC47_RS13215 (FORC47_2467) | - | 2528277..2528690 (+) | 414 | WP_089171107.1 | hypothetical protein | - |
| FORC47_RS13220 (FORC47_2468) | - | 2528671..2529012 (+) | 342 | WP_089171108.1 | HNH endonuclease | - |
| FORC47_RS13225 (FORC47_2469) | - | 2529165..2529500 (+) | 336 | WP_000124842.1 | P27 family phage terminase small subunit | - |
| FORC47_RS13230 (FORC47_2470) | - | 2529497..2531155 (+) | 1659 | WP_000615659.1 | terminase TerL endonuclease subunit | - |
| FORC47_RS13235 (FORC47_2471) | - | 2531221..2532327 (+) | 1107 | WP_089172120.1 | phage portal protein | - |
| FORC47_RS13240 (FORC47_2472) | - | 2532311..2533093 (+) | 783 | WP_089171109.1 | head maturation protease, ClpP-related | - |
| FORC47_RS13245 (FORC47_2473) | - | 2533097..2534251 (+) | 1155 | WP_089171110.1 | phage major capsid protein | - |
| FORC47_RS13250 (FORC47_2474) | - | 2534257..2534550 (+) | 294 | WP_029442425.1 | hypothetical protein | - |
| FORC47_RS13255 (FORC47_2475) | - | 2534552..2534905 (+) | 354 | WP_089171111.1 | phage head closure protein | - |
| FORC47_RS13260 (FORC47_2476) | - | 2534907..2535251 (+) | 345 | WP_050843028.1 | HK97 gp10 family phage protein | - |
| FORC47_RS13265 (FORC47_2477) | - | 2535248..2535577 (+) | 330 | WP_071730276.1 | hypothetical protein | - |
| FORC47_RS13270 (FORC47_2478) | - | 2535578..2536174 (+) | 597 | WP_089171112.1 | major tail protein | - |
| FORC47_RS13275 (FORC47_2479) | - | 2536179..2536541 (+) | 363 | WP_016124652.1 | hypothetical protein | - |
| FORC47_RS13285 (FORC47_2481) | - | 2536772..2538229 (+) | 1458 | Protein_2470 | DUF2207 domain-containing protein | - |
| FORC47_RS13290 (FORC47_2482) | - | 2538453..2540606 (+) | 2154 | WP_089171113.1 | phage tail tape measure protein | - |
| FORC47_RS13295 (FORC47_2483) | - | 2540648..2542105 (+) | 1458 | WP_089171114.1 | distal tail protein Dit | - |
| FORC47_RS13300 (FORC47_2484) | - | 2542102..2546442 (+) | 4341 | WP_089171115.1 | phage tail spike protein | - |
| FORC47_RS13305 (FORC47_2485) | - | 2546458..2546787 (+) | 330 | WP_000429937.1 | hypothetical protein | - |
| FORC47_RS13310 (FORC47_2486) | - | 2546917..2547141 (+) | 225 | WP_000390479.1 | hypothetical protein | - |
| FORC47_RS13315 (FORC47_2487) | - | 2547217..2547642 (+) | 426 | WP_089171116.1 | phage holin family protein | - |
| FORC47_RS13320 (FORC47_2488) | - | 2547642..2548451 (+) | 810 | WP_089171117.1 | GH25 family lysozyme | - |
| FORC47_RS13325 (FORC47_2489) | - | 2548649..2549155 (-) | 507 | WP_089171118.1 | hypothetical protein | - |
| FORC47_RS13330 (FORC47_2491) | - | 2549609..2550340 (-) | 732 | WP_089171119.1 | coiled-coil domain-containing protein | - |
| FORC47_RS31205 (FORC47_2492) | - | 2550917..2551120 (+) | 204 | Protein_2480 | N-acetylmuramoyl-L-alanine amidase | - |
| FORC47_RS13340 (FORC47_2493) | - | 2551157..2552047 (+) | 891 | WP_089171121.1 | exosporium leader peptide-containing protein | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10127.77 Da Isoelectric Point: 5.7189
>NTDB_id=194870 FORC47_RS13095 WP_089171094.1 2514283..2514561(+) (abrB) [Bacillus cereus strain FORC_047]
MKNTGVARKVDELGRIVIPVELRRTLGIVEGTALDFHVDGENIVLRKYEKSCFVTGEVSETNIELLGGRMFLSKEGAIEL
LDLIQKSGMAHA
MKNTGVARKVDELGRIVIPVELRRTLGIVEGTALDFHVDGENIVLRKYEKSCFVTGEVSETNIELLGGRMFLSKEGAIEL
LDLIQKSGMAHA
Nucleotide
Download Length: 279 bp
>NTDB_id=194870 FORC47_RS13095 WP_089171094.1 2514283..2514561(+) (abrB) [Bacillus cereus strain FORC_047]
ATGAAAAACACAGGCGTTGCAAGAAAAGTGGACGAGCTAGGTCGTATAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGTCGAAGGTACGGCACTAGATTTTCATGTCGATGGGGAAAACATTGTTCTAAGAAAATATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA
ATGAAAAACACAGGCGTTGCAAGAAAAGTGGACGAGCTAGGTCGTATAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGTCGAAGGTACGGCACTAGATTTTCATGTCGATGGGGAAAACATTGTTCTAAGAAAATATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
59.77 |
94.565 |
0.565 |