Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | S100027_RS17815 | Genome accession | NZ_CP021677 |
| Coordinates | 3374515..3374655 (-) | Length | 46 a.a. |
| NCBI ID | WP_003184860.1 | Uniprot ID | A0ABM6LMF9 |
| Organism | Bacillus licheniformis strain SRCM100027 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3369515..3379655
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| S100027_RS17790 (S100027_03573) | - | 3369835..3370224 (-) | 390 | WP_009329508.1 | hotdog fold thioesterase | - |
| S100027_RS17795 (S100027_03574) | comA | 3370241..3370879 (-) | 639 | WP_003184849.1 | response regulator transcription factor | Regulator |
| S100027_RS17800 (S100027_03575) | comP | 3370966..3373266 (-) | 2301 | WP_009329509.1 | ATP-binding protein | Regulator |
| S100027_RS17805 (S100027_03576) | comX | 3373268..3373441 (-) | 174 | WP_009329510.1 | competence pheromone ComX | - |
| S100027_RS17810 (S100027_03577) | comQ | 3373445..3374326 (-) | 882 | WP_009329511.1 | polyprenyl synthetase family protein | Regulator |
| S100027_RS17815 (S100027_03578) | degQ | 3374515..3374655 (-) | 141 | WP_003184860.1 | degradation enzyme regulation protein DegQ | Regulator |
| S100027_RS17825 (S100027_03580) | - | 3375141..3375488 (+) | 348 | WP_009329512.1 | hypothetical protein | - |
| S100027_RS17830 (S100027_03581) | - | 3375531..3376751 (-) | 1221 | WP_003184864.1 | EAL and HDOD domain-containing protein | - |
| S100027_RS17835 (S100027_03582) | - | 3376930..3378399 (-) | 1470 | WP_003184866.1 | nicotinate phosphoribosyltransferase | - |
| S100027_RS17840 (S100027_03583) | - | 3378417..3378968 (-) | 552 | WP_003184868.1 | cysteine hydrolase family protein | - |
| S100027_RS17845 (S100027_03584) | - | 3379153..3379554 (-) | 402 | WP_003184870.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5747.56 Da Isoelectric Point: 8.4596
>NTDB_id=194802 S100027_RS17815 WP_003184860.1 3374515..3374655(-) (degQ) [Bacillus licheniformis strain SRCM100027]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
Nucleotide
Download Length: 141 bp
>NTDB_id=194802 S100027_RS17815 WP_003184860.1 3374515..3374655(-) (degQ) [Bacillus licheniformis strain SRCM100027]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATTTAAAAACCTCGTAA
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATTTAAAAACCTCGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
71.429 |
91.304 |
0.652 |