Detailed information NTG0194775

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: S100027_RS13685
• Genome accession: NZ_CP021677
• Coordinates: 2615501..2615938 (-)
• Length: 145 a.a.
• NCBI ID: WP_009327905.1
• Uniprot ID: Q8VQ70
• Organism: Bacillus licheniformis strain SRCM100027
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2610501..2620938

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
S100027_RS13635 (S100027_02738)	sinI	2610676..2610852 (+)	177	WP_003183444.1	anti-repressor SinI	Regulator
S100027_RS13640 (S100027_02739)	sinR	2610886..2611221 (+)	336	WP_006637528.1	transcriptional regulator SinR	Regulator
S100027_RS13645 (S100027_02740)	tasA	2611326..2612120 (-)	795	WP_003183447.1	biofilm matrix protein TasA	-
S100027_RS13650 (S100027_02741)	sipW	2612194..2612778 (-)	585	WP_003183449.1	signal peptidase I SipW	-
S100027_RS13655 (S100027_02742)	tapA	2612775..2613503 (-)	729	WP_003183451.1	amyloid fiber anchoring/assembly protein TapA	-
S100027_RS13660 (S100027_02743)	-	2613780..2614100 (+)	321	WP_003183454.1	YqzG/YhdC family protein	-
S100027_RS13665 (S100027_02744)	-	2614124..2614306 (-)	183	WP_003183456.1	YqzE family protein	-
S100027_RS13670 (S100027_02745)	comGG	2614395..2614760 (-)	366	WP_003183459.1	competence type IV pilus minor pilin ComGG	-
S100027_RS13675 (S100027_02746)	comGF	2614773..2615261 (-)	489	WP_011201694.1	competence type IV pilus minor pilin ComGF	-
S100027_RS13680	comGE	2615170..2615517 (-)	348	WP_009327907.1	competence type IV pilus minor pilin ComGE	-
S100027_RS13685 (S100027_02747)	comGD	2615501..2615938 (-)	438	WP_009327905.1	competence type IV pilus minor pilin ComGD	Machinery gene
S100027_RS13690 (S100027_02748)	comGC	2615944..2616237 (-)	294	WP_003183466.1	competence type IV pilus major pilin ComGC	Machinery gene
S100027_RS13695 (S100027_02749)	comGB	2616251..2617285 (-)	1035	WP_080626943.1	competence type IV pilus assembly protein ComGB	Machinery gene
S100027_RS13700 (S100027_02750)	comGA	2617275..2618339 (-)	1065	WP_073425737.1	competence type IV pilus ATPase ComGA	Machinery gene
S100027_RS13705 (S100027_02751)	-	2618496..2619335 (-)	840	WP_080626944.1	STAS domain-containing protein	-
S100027_RS13715 (S100027_02753)	-	2619577..2619954 (-)	378	WP_003183482.1	Spx/MgsR family RNA polymerase-binding regulatory protein	-
S100027_RS13720 (S100027_02754)	-	2620163..2620408 (+)	246	WP_003183483.1	DUF2626 domain-containing protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16249.07 Da
• Isoelectric Point: 9.6739

>NTDB_id=194775 S100027_RS13685 WP_009327905.1 2615501..2615938(-) (comGD) [Bacillus licheniformis strain SRCM100027]
MNQKGFTLLESLTVLMIGSIMFSLLFALLPPIYEKRIVQHFVSQLEEDLLYAQQTALVRHTTVKVQFDFAGCRYIMKHSD
EGSSPELVRTYSCNIAIKKSTLKPILTFNPSGVPNQGGKIVIDTQHASFILTIYLGSGKINVQKK

Nucleotide

• Length: 438 bp

>NTDB_id=194775 S100027_RS13685 WP_009327905.1 2615501..2615938(-) (comGD) [Bacillus licheniformis strain SRCM100027]
ATGAATCAAAAAGGATTTACGCTTTTGGAAAGTTTAACTGTATTGATGATCGGTTCTATTATGTTCTCTCTTCTCTTTGC
TCTACTGCCTCCCATTTATGAAAAAAGAATCGTTCAGCACTTTGTCTCACAGCTTGAAGAGGATTTGCTTTACGCTCAGC
AGACGGCTCTCGTCCGCCATACGACGGTTAAGGTGCAGTTTGACTTTGCCGGCTGCCGCTATATCATGAAGCATTCGGAC
GAAGGCTCATCGCCTGAACTGGTCAGGACATACAGCTGCAATATCGCAATCAAAAAGTCGACGCTCAAACCAATTCTTAC
TTTTAATCCAAGCGGTGTTCCGAATCAAGGGGGAAAGATCGTGATCGATACACAGCATGCCTCTTTTATACTGACGATCT
ATTTAGGAAGCGGAAAGATTAATGTTCAAAAAAAATAA

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

3D structure

• AlphaFold DB: Q8VQ70

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	39.86	98.621	0.393