Detailed information
Bioinformatically predicted
Overview
| Name | dprB | Type | Machinery gene |
| Locus tag | CPIN18020_RS01335 | Genome accession | NZ_CP017018 |
| Coordinates | 247491..247877 (+) | Length | 128 a.a. |
| NCBI ID | WP_078422835.1 | Uniprot ID | A0A1S6U5V4 |
| Organism | Campylobacter pinnipediorum subsp. caledonicus strain M302/10/6 | ||
| Function | homologous recombination (predicted from homology) Homologous recombination |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 201439..259632 | 247491..247877 | within | 0 |
Gene organization within MGE regions
Location: 201439..259632
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CPIN18020_RS01030 (CPIN18020_0206) | - | 201439..202062 (-) | 624 | WP_078422778.1 | hypothetical protein | - |
| CPIN18020_RS01035 (CPIN18020_0207) | - | 202059..202421 (-) | 363 | WP_078422779.1 | helix-turn-helix transcriptional regulator | - |
| CPIN18020_RS01040 (CPIN18020_0208) | - | 202541..202759 (+) | 219 | WP_078422780.1 | hypothetical protein | - |
| CPIN18020_RS01045 (CPIN18020_0209) | - | 202759..204777 (+) | 2019 | WP_078422781.1 | DDE-type integrase/transposase/recombinase | - |
| CPIN18020_RS01050 (CPIN18020_0210) | - | 204851..205771 (+) | 921 | WP_078422782.1 | AAA family ATPase | - |
| CPIN18020_RS01055 (CPIN18020_0211) | - | 205786..206031 (+) | 246 | WP_078422783.1 | hypothetical protein | - |
| CPIN18020_RS01060 (CPIN18020_0212) | - | 206098..206475 (+) | 378 | WP_078422784.1 | DUF1937 family protein | - |
| CPIN18020_RS08800 | - | 206469..206600 (+) | 132 | WP_257787929.1 | hypothetical protein | - |
| CPIN18020_RS01065 (CPIN18020_0213) | - | 206665..207084 (+) | 420 | WP_078422785.1 | hypothetical protein | - |
| CPIN18020_RS01070 (CPIN18020_0214) | - | 207163..207795 (+) | 633 | WP_078422786.1 | hypothetical protein | - |
| CPIN18020_RS01075 (CPIN18020_0215) | - | 207792..208199 (+) | 408 | WP_078422787.1 | phage protein GemA/Gp16 family protein | - |
| CPIN18020_RS01080 (CPIN18020_0216) | - | 208192..208470 (+) | 279 | WP_078422788.1 | hypothetical protein | - |
| CPIN18020_RS08500 (CPIN18020_0217) | - | 208500..208676 (+) | 177 | WP_157886643.1 | hypothetical protein | - |
| CPIN18020_RS01085 (CPIN18020_0218) | - | 208673..209359 (+) | 687 | WP_078422789.1 | hypothetical protein | - |
| CPIN18020_RS01090 (CPIN18020_0219) | - | 209381..209740 (+) | 360 | WP_078422790.1 | hypothetical protein | - |
| CPIN18020_RS01095 (CPIN18020_0220) | - | 209765..209998 (+) | 234 | WP_078422791.1 | hypothetical protein | - |
| CPIN18020_RS01100 (CPIN18020_0221) | - | 210426..211073 (+) | 648 | WP_078422792.1 | BRO family protein | - |
| CPIN18020_RS01105 (CPIN18020_0222) | - | 211070..211282 (+) | 213 | WP_078422793.1 | hypothetical protein | - |
| CPIN18020_RS01110 (CPIN18020_0223) | - | 211301..211762 (-) | 462 | WP_078422794.1 | phage virion morphogenesis protein | - |
| CPIN18020_RS01115 (CPIN18020_0224) | - | 211886..213100 (-) | 1215 | WP_078422795.1 | phage minor head protein | - |
| CPIN18020_RS01120 (CPIN18020_0225) | - | 213093..214451 (-) | 1359 | WP_078422796.1 | phage portal protein family protein | - |
| CPIN18020_RS01125 (CPIN18020_0226) | terL | 214455..216098 (-) | 1644 | WP_078422797.1 | phage terminase large subunit | - |
| CPIN18020_RS01130 (CPIN18020_0227) | - | 216098..216595 (-) | 498 | WP_078422798.1 | DUF1804 family protein | - |
| CPIN18020_RS01135 (CPIN18020_0228) | - | 216605..217000 (-) | 396 | WP_078422799.1 | phage protein Gp36 family protein | - |
| CPIN18020_RS01140 (CPIN18020_0229) | - | 217132..218103 (-) | 972 | WP_078422800.1 | major capsid protein | - |
| CPIN18020_RS01145 (CPIN18020_0230) | - | 218107..218436 (-) | 330 | WP_078422801.1 | hypothetical protein | - |
| CPIN18020_RS01150 (CPIN18020_0231) | - | 218439..219254 (-) | 816 | WP_078422802.1 | phage protease | - |
| CPIN18020_RS01155 (CPIN18020_0232) | - | 219251..219739 (-) | 489 | WP_078422803.1 | hypothetical protein | - |
| CPIN18020_RS01160 (CPIN18020_0233) | - | 219850..220317 (+) | 468 | WP_226995921.1 | DUF5675 family protein | - |
| CPIN18020_RS01165 (CPIN18020_0234) | - | 220317..220670 (+) | 354 | WP_078422805.1 | hypothetical protein | - |
| CPIN18020_RS01170 (CPIN18020_0235) | - | 220663..220902 (+) | 240 | WP_078422806.1 | hypothetical protein | - |
| CPIN18020_RS01175 (CPIN18020_0236) | - | 220899..221084 (+) | 186 | WP_078422807.1 | hypothetical protein | - |
| CPIN18020_RS01180 (CPIN18020_0237) | - | 221086..221358 (+) | 273 | WP_078422808.1 | hypothetical protein | - |
| CPIN18020_RS01185 (CPIN18020_0238) | - | 221362..221976 (+) | 615 | WP_226995922.1 | phage baseplate assembly protein V | - |
| CPIN18020_RS01190 (CPIN18020_0239) | - | 222078..222362 (+) | 285 | WP_078422809.1 | GPW/gp25 family protein | - |
| CPIN18020_RS01195 (CPIN18020_0240) | - | 222359..223444 (+) | 1086 | WP_078422810.1 | baseplate assembly protein | - |
| CPIN18020_RS01200 (CPIN18020_0241) | - | 223441..224061 (+) | 621 | WP_078422811.1 | phage tail protein | - |
| CPIN18020_RS01205 (CPIN18020_0242) | - | 224058..225500 (+) | 1443 | WP_078422812.1 | phage tail protein | - |
| CPIN18020_RS01210 (CPIN18020_0243) | - | 225510..226121 (+) | 612 | WP_078422813.1 | hypothetical protein | - |
| CPIN18020_RS01215 (CPIN18020_0244) | - | 226124..226492 (+) | 369 | WP_226995923.1 | DUF1353 domain-containing protein | - |
| CPIN18020_RS01220 (CPIN18020_0245) | - | 226508..227668 (+) | 1161 | WP_078422814.1 | phage tail sheath family protein | - |
| CPIN18020_RS01225 (CPIN18020_0246) | - | 227843..228358 (+) | 516 | WP_078422815.1 | phage major tail tube protein | - |
| CPIN18020_RS01230 (CPIN18020_0247) | - | 228580..228822 (+) | 243 | WP_078422816.1 | phage tail assembly protein | - |
| CPIN18020_RS01235 (CPIN18020_0248) | - | 229192..229440 (+) | 249 | WP_078422817.1 | hypothetical protein | - |
| CPIN18020_RS01240 (CPIN18020_0249) | - | 229457..231742 (+) | 2286 | WP_078422818.1 | phage tail tape measure protein | - |
| CPIN18020_RS01245 (CPIN18020_0250) | - | 231747..232118 (+) | 372 | WP_078422819.1 | phage tail protein | - |
| CPIN18020_RS01250 (CPIN18020_0251) | - | 232115..232306 (+) | 192 | WP_078422820.1 | tail protein X | - |
| CPIN18020_RS01255 (CPIN18020_0252) | - | 232300..233274 (+) | 975 | WP_078422821.1 | phage late control D family protein | - |
| CPIN18020_RS01260 (CPIN18020_0253) | - | 233368..234123 (+) | 756 | WP_078422822.1 | DNA adenine methylase | - |
| CPIN18020_RS01265 (CPIN18020_0254) | - | 234201..234860 (+) | 660 | WP_078422823.1 | S24 family peptidase | - |
| CPIN18020_RS01270 (CPIN18020_0256) | - | 235319..236062 (-) | 744 | WP_078422824.1 | HugZ family heme oxygenase | - |
| CPIN18020_RS01275 (CPIN18020_0257) | - | 236394..237101 (-) | 708 | WP_089503397.1 | plasminogen-binding N-terminal domain-containing protein | - |
| CPIN18020_RS01280 (CPIN18020_0258) | - | 237226..238395 (+) | 1170 | WP_078422826.1 | M23 family metallopeptidase | - |
| CPIN18020_RS01285 (CPIN18020_0259) | mgtE | 238407..239774 (+) | 1368 | WP_078422827.1 | magnesium transporter | - |
| CPIN18020_RS01290 (CPIN18020_0260) | - | 239759..240355 (+) | 597 | WP_078422828.1 | NUDIX hydrolase | - |
| CPIN18020_RS01295 (CPIN18020_0261) | - | 240352..240867 (+) | 516 | WP_078422829.1 | tetratricopeptide repeat protein | - |
| CPIN18020_RS01300 (CPIN18020_0262) | - | 240903..243149 (-) | 2247 | WP_226995924.1 | molybdopterin oxidoreductase family protein | - |
| CPIN18020_RS01310 (CPIN18020_0263) | - | 243419..244078 (+) | 660 | WP_078422832.1 | Crp/Fnr family transcriptional regulator | - |
| CPIN18020_RS01315 (CPIN18020_0264) | - | 244111..245289 (+) | 1179 | WP_418225559.1 | replication-associated recombination protein A | - |
| CPIN18020_RS01320 (CPIN18020_0265) | moaC | 245531..246004 (+) | 474 | WP_180374474.1 | cyclic pyranopterin monophosphate synthase MoaC | - |
| CPIN18020_RS01325 (CPIN18020_0266) | - | 245985..246248 (+) | 264 | WP_226995925.1 | DUF493 family protein | - |
| CPIN18020_RS01330 (CPIN18020_0267) | - | 246261..247478 (+) | 1218 | WP_078422834.1 | hypothetical protein | - |
| CPIN18020_RS01335 (CPIN18020_0268) | dprB | 247491..247877 (+) | 387 | WP_078422835.1 | Holliday junction resolvase RuvX | Machinery gene |
| CPIN18020_RS01340 (CPIN18020_0269) | - | 247890..249524 (+) | 1635 | WP_226995926.1 | multidrug ABC transporter permease/ATP-binding protein | - |
| CPIN18020_RS01345 (CPIN18020_0270) | - | 249574..250287 (+) | 714 | WP_078422836.1 | NADH dehydrogenase | - |
| CPIN18020_RS01350 (CPIN18020_0271) | - | 250287..252656 (+) | 2370 | WP_078422837.1 | tetratricopeptide repeat protein | - |
| CPIN18020_RS01355 (CPIN18020_0272) | - | 252683..255607 (+) | 2925 | WP_162272893.1 | S8 family serine peptidase | - |
| CPIN18020_RS01375 (CPIN18020_0276) | - | 258485..259252 (+) | 768 | WP_157886645.1 | DNA ligase | - |
| CPIN18020_RS01380 (CPIN18020_0277) | - | 259291..259632 (-) | 342 | WP_078422840.1 | M15 family metallopeptidase | - |
Sequence
Protein
Download Length: 128 a.a. Molecular weight: 14392.70 Da Isoelectric Point: 8.4625
>NTDB_id=194519 CPIN18020_RS01335 WP_078422835.1 247491..247877(+) (dprB) [Campylobacter pinnipediorum subsp. caledonicus strain M302/10/6]
MNDEKFIAIDIGLKRIGLAFGFKGVVVPLTPILRKNRNQASRDISRVLDEYNADILVVGVPIGGSSEDEMRRRILHFVSL
LDFTGKIIYQDESFSSFEAADFVKDKRDGKLDSMAALIILKRYLQISA
MNDEKFIAIDIGLKRIGLAFGFKGVVVPLTPILRKNRNQASRDISRVLDEYNADILVVGVPIGGSSEDEMRRRILHFVSL
LDFTGKIIYQDESFSSFEAADFVKDKRDGKLDSMAALIILKRYLQISA
Nucleotide
Download Length: 387 bp
>NTDB_id=194519 CPIN18020_RS01335 WP_078422835.1 247491..247877(+) (dprB) [Campylobacter pinnipediorum subsp. caledonicus strain M302/10/6]
ATGAATGATGAAAAATTTATAGCCATAGATATCGGCTTAAAGCGTATAGGATTGGCTTTCGGATTTAAGGGCGTTGTTGT
TCCTCTTACGCCTATACTTAGGAAAAATCGCAACCAAGCATCAAGAGATATCAGTAGGGTTTTAGATGAATATAATGCTG
ATATTTTGGTTGTTGGAGTGCCTATTGGTGGAAGTAGTGAGGATGAGATGAGAAGAAGAATATTGCATTTTGTATCCTTG
CTTGATTTTACTGGAAAGATTATATATCAAGATGAATCGTTTAGCAGCTTTGAGGCTGCTGATTTTGTAAAAGATAAAAG
AGATGGTAAGCTTGATAGCATGGCTGCACTAATAATACTAAAAAGATATTTGCAAATATCTGCATAA
ATGAATGATGAAAAATTTATAGCCATAGATATCGGCTTAAAGCGTATAGGATTGGCTTTCGGATTTAAGGGCGTTGTTGT
TCCTCTTACGCCTATACTTAGGAAAAATCGCAACCAAGCATCAAGAGATATCAGTAGGGTTTTAGATGAATATAATGCTG
ATATTTTGGTTGTTGGAGTGCCTATTGGTGGAAGTAGTGAGGATGAGATGAGAAGAAGAATATTGCATTTTGTATCCTTG
CTTGATTTTACTGGAAAGATTATATATCAAGATGAATCGTTTAGCAGCTTTGAGGCTGCTGATTTTGTAAAAGATAAAAG
AGATGGTAAGCTTGATAGCATGGCTGCACTAATAATACTAAAAAGATATTTGCAAATATCTGCATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| dprB | Helicobacter pylori 26695 |
48.062 |
100 |
0.484 |