Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BFI33_RS17260 Genome accession   NZ_CP016852
Coordinates   3256463..3256603 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain 168G     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3251463..3261603
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BFI33_RS17235 (BFI33_17235) yuxO 3251776..3252156 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  BFI33_RS17240 (BFI33_17240) comA 3252175..3252819 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  BFI33_RS17245 (BFI33_17245) comP 3252900..3255209 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  BFI33_RS17250 (BFI33_17250) comX 3255224..3255391 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  BFI33_RS17255 (BFI33_17255) comQ 3255379..3256278 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  BFI33_RS17260 (BFI33_17260) degQ 3256463..3256603 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  BFI33_RS22965 - 3256825..3256950 (+) 126 WP_003228793.1 hypothetical protein -
  BFI33_RS17265 (BFI33_17265) - 3257064..3257432 (+) 369 WP_003243784.1 hypothetical protein -
  BFI33_RS17270 (BFI33_17270) pdeH 3257408..3258637 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  BFI33_RS17275 (BFI33_17275) pncB 3258774..3260246 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  BFI33_RS17280 (BFI33_17280) pncA 3260262..3260813 (-) 552 WP_003243099.1 cysteine hydrolase family protein -
  BFI33_RS17285 (BFI33_17285) yueI 3260910..3261308 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=192802 BFI33_RS17260 WP_003220708.1 3256463..3256603(-) (degQ) [Bacillus subtilis subsp. subtilis strain 168G]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=192802 BFI33_RS17260 WP_003220708.1 3256463..3256603(-) (degQ) [Bacillus subtilis subsp. subtilis strain 168G]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment