Detailed information    

insolico Bioinformatically predicted

Overview

Name   comZ   Type   Regulator
Locus tag   BFI33_RS06300 Genome accession   NZ_CP016852
Coordinates   1207054..1207245 (+) Length   63 a.a.
NCBI ID   WP_003224559.1    Uniprot ID   G4NWD2
Organism   Bacillus subtilis subsp. subtilis strain 168G     
Function   repression of comG operon (predicted from homology)   
Competence regulation

Genomic Context

Location: 1202054..1212245
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BFI33_RS06270 (BFI33_06270) argF 1202918..1203877 (+) 960 WP_003232980.1 ornithine carbamoyltransferase -
  BFI33_RS06275 (BFI33_06275) yjzC 1203963..1204142 (+) 180 WP_003245356.1 YjzC family protein -
  BFI33_RS06280 (BFI33_06280) yjzD 1204188..1204373 (-) 186 WP_003245236.1 YjzD family protein -
  BFI33_RS06285 (BFI33_06285) - 1204622..1205356 (+) 735 WP_003245223.1 hypothetical protein -
  BFI33_RS06290 (BFI33_06290) - 1205438..1205995 (+) 558 WP_003232974.1 hypothetical protein -
  BFI33_RS06295 (BFI33_06295) med 1206086..1207039 (+) 954 WP_003245494.1 transcriptional regulator Med Regulator
  BFI33_RS06300 (BFI33_06300) comZ 1207054..1207245 (+) 192 WP_003224559.1 ComG operon transcriptional repressor ComZ Regulator
  BFI33_RS06305 (BFI33_06305) yjzB 1207275..1207514 (-) 240 WP_003232972.1 spore coat protein YjzB -
  BFI33_RS06310 (BFI33_06310) fabH 1207679..1208617 (+) 939 WP_003232971.1 beta-ketoacyl-ACP synthase III -
  BFI33_RS06315 (BFI33_06315) fabF 1208640..1209881 (+) 1242 WP_003244890.1 beta-ketoacyl-ACP synthase II -
  BFI33_RS06320 (BFI33_06320) yjaZ 1209957..1210742 (+) 786 WP_003232967.1 DUF2268 domain-containing protein -
  BFI33_RS06325 (BFI33_06325) appD 1210934..1211920 (+) 987 WP_003232965.1 oligopeptide ABC transporter ATP-binding protein AppD -

Sequence

Protein


Download         Length: 63 a.a.        Molecular weight: 7214.27 Da        Isoelectric Point: 4.2564

>NTDB_id=192758 BFI33_RS06300 WP_003224559.1 1207054..1207245(+) (comZ) [Bacillus subtilis subsp. subtilis strain 168G]
MQHEKSLEFLQIAMKYLPEAKEQLEKSGIELSMEAIQPFMNLFTTVMAEAYELGKSDAKSETE

Nucleotide


Download         Length: 192 bp        

>NTDB_id=192758 BFI33_RS06300 WP_003224559.1 1207054..1207245(+) (comZ) [Bacillus subtilis subsp. subtilis strain 168G]
ATGCAGCACGAAAAATCACTTGAATTCTTGCAAATTGCCATGAAATATCTCCCTGAAGCGAAAGAACAGCTTGAGAAATC
AGGCATTGAGCTCTCAATGGAGGCCATCCAGCCGTTTATGAATCTATTTACAACGGTAATGGCGGAAGCTTATGAGCTTG
GCAAGTCTGACGCTAAATCTGAAACAGAATAA

Domains

Predicted by InterproScan.

ComZ (ComZ)

(4-58)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4NWD2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comZ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment