Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   FORC43_RS18035 Genome accession   NZ_CP016828
Coordinates   3362599..3363228 (-) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain FORC_043     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3347028..3389031 3362599..3363228 within 0


Gene organization within MGE regions


Location: 3347028..3389031
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FORC43_RS17935 (FORC43_3488) - 3347239..3347394 (+) 156 WP_088888725.1 DUF1391 family protein -
  FORC43_RS29430 (FORC43_3489) ydfB 3347396..3347524 (+) 129 WP_000344969.1 protein YdfB -
  FORC43_RS17945 (FORC43_3490) ydfC 3347554..3347772 (+) 219 WP_042343674.1 protein YdfC -
  FORC43_RS17955 (FORC43_3492) dicB 3348330..3348518 (+) 189 WP_000450222.1 cell division inhibition protein DicB -
  FORC43_RS17960 - 3348515..3348703 (+) 189 WP_086163675.1 DUF1482 family protein -
  FORC43_RS29265 - 3348937..3349302 (+) 366 Protein_3317 RecE family exodeoxyribonuclease -
  FORC43_RS29760 - 3349651..3351234 (+) 1584 WP_420536501.1 3'-5' exoribonuclease domain-containing protein -
  FORC43_RS17970 (FORC43_3495) - 3351301..3351552 (+) 252 WP_000273163.1 DUF4224 domain-containing protein -
  FORC43_RS17975 (FORC43_3496) - 3351521..3352540 (+) 1020 WP_001367167.1 tyrosine-type recombinase/integrase -
  FORC43_RS17980 (FORC43_3498) yccA 3352948..3353607 (+) 660 WP_000375136.1 FtsH protease modulator YccA -
  FORC43_RS17985 (FORC43_3499) tusE 3353698..3354027 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  FORC43_RS17990 (FORC43_3500) yccX 3354024..3354302 (-) 279 WP_000048243.1 acylphosphatase -
  FORC43_RS17995 (FORC43_3501) rlmI 3354397..3355587 (+) 1191 WP_000116288.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  FORC43_RS18000 (FORC43_3502) hspQ 3355645..3355962 (+) 318 WP_001295356.1 heat shock protein HspQ -
  FORC43_RS18005 (FORC43_3503) yccU 3356007..3356420 (-) 414 WP_000665217.1 CoA-binding protein -
  FORC43_RS18010 (FORC43_3505) csgI 3356593..3357255 (+) 663 WP_000847785.1 DUF2057 family protein -
  FORC43_RS18015 (FORC43_3506) mgsA 3357351..3357809 (+) 459 WP_001386685.1 methylglyoxal synthase -
  FORC43_RS18020 (FORC43_3507) helD 3357841..3359895 (-) 2055 WP_000420536.1 DNA helicase IV -
  FORC43_RS18025 (FORC43_3508) yccF 3360018..3360464 (+) 447 WP_001261231.1 YccF domain-containing protein -
  FORC43_RS18030 (FORC43_3509) yccS 3360474..3362636 (+) 2163 WP_000875044.1 YccS family putative transporter -
  FORC43_RS18035 (FORC43_3510) sxy/tfoX 3362599..3363228 (-) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  FORC43_RS18040 (FORC43_3511) sulA 3363447..3363956 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  FORC43_RS18050 (FORC43_3512) ompA 3364313..3365353 (+) 1041 WP_000750416.1 porin OmpA -
  FORC43_RS18055 (FORC43_3513) matP 3365429..3365881 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  FORC43_RS18060 (FORC43_3514) ycbZ 3366067..3367827 (+) 1761 WP_000156526.1 AAA family ATPase -
  FORC43_RS18065 (FORC43_3515) fabA 3367896..3368414 (+) 519 WP_001386684.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  FORC43_RS18070 rmf 3368484..3368651 (-) 168 WP_000828648.1 ribosome modulation factor -
  FORC43_RS18075 (FORC43_3516) pqiC 3368907..3369470 (-) 564 WP_000759123.1 membrane integrity-associated transporter subunit PqiC -
  FORC43_RS18080 (FORC43_3517) pqiB 3369467..3371107 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  FORC43_RS18085 (FORC43_3518) pqiA 3371112..3372365 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  FORC43_RS18090 (FORC43_3519) uup 3372495..3374402 (-) 1908 WP_000053089.1 ABC transporter ATP-binding protein -
  FORC43_RS18095 (FORC43_3520) rlmKL 3374413..3376521 (-) 2109 WP_001086517.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  FORC43_RS18100 (FORC43_3521) ycbX 3376765..3377874 (+) 1110 WP_000258204.1 6-N-hydroxylaminopurine resistance protein YcbX -
  FORC43_RS18105 (FORC43_3522) zapC 3377871..3378413 (-) 543 WP_001295353.1 cell division protein ZapC -
  FORC43_RS18110 (FORC43_3523) pyrD 3378587..3379597 (-) 1011 WP_001295352.1 quinone-dependent dihydroorotate dehydrogenase -
  FORC43_RS18115 (FORC43_3524) ycbF 3379708..3380445 (-) 738 WP_001111470.1 fimbrial chaperone -
  FORC43_RS18120 (FORC43_3525) ycbV 3380411..3380926 (-) 516 WP_000919489.1 fimbrial protein -
  FORC43_RS18125 (FORC43_3526) ycbU 3380934..3381476 (-) 543 WP_000730614.1 fimbrial protein -
  FORC43_RS18130 (FORC43_3527) elfG 3381488..3382558 (-) 1071 WP_001165657.1 fimbrial protein -
  FORC43_RS18135 (FORC43_3528) - 3382549..3384597 (-) 2049 Protein_3351 fimbrial biogenesis usher protein -
  FORC43_RS18140 (FORC43_3529) - 3384850..3385380 (-) 531 WP_000077538.1 hypothetical protein -
  FORC43_RS18145 - 3385570..3385818 (+) 249 WP_001310454.1 helix-turn-helix domain-containing protein -
  FORC43_RS18150 (FORC43_3531) - 3385820..3387910 (+) 2091 WP_000289277.1 Mu transposase C-terminal domain-containing protein -
  FORC43_RS18155 (FORC43_3532) - 3387982..3388914 (+) 933 WP_000129797.1 AAA family ATPase -

Sequence

Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=192515 FORC43_RS18035 WP_000839153.1 3362599..3363228(-) (sxy/tfoX) [Escherichia coli strain FORC_043]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=192515 FORC43_RS18035 WP_000839153.1 3362599..3363228(-) (sxy/tfoX) [Escherichia coli strain FORC_043]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX N-terminal domain (TfoX_N)

(14-106)

TfoX C-terminal domain (TfoX_C)

(116-194)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1

Multiple sequence alignment