Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BEN31_RS01760 Genome accession   NZ_CP016784
Coordinates   322099..322239 (+) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus pumilus strain PDSLzg-1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 317099..327239
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BEN31_RS01735 (BEN31_01735) - 317335..317742 (+) 408 WP_060597219.1 YueI family protein -
  BEN31_RS01740 (BEN31_01740) - 317803..318354 (+) 552 WP_060597218.1 cysteine hydrolase family protein -
  BEN31_RS01745 (BEN31_01745) - 318432..319841 (+) 1410 WP_231135465.1 nicotinate phosphoribosyltransferase -
  BEN31_RS01750 (BEN31_01750) - 319980..321206 (+) 1227 WP_060597217.1 EAL and HDOD domain-containing protein -
  BEN31_RS01755 (BEN31_01755) - 321240..321593 (-) 354 WP_060597216.1 hypothetical protein -
  BEN31_RS01760 (BEN31_01760) degQ 322099..322239 (+) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  BEN31_RS01765 (BEN31_01765) - 322391..323305 (+) 915 WP_081311379.1 polyprenyl synthetase family protein -
  BEN31_RS18850 comX 323302..323469 (+) 168 WP_081311380.1 competence pheromone ComX -
  BEN31_RS01770 (BEN31_01770) comP 323526..325838 (+) 2313 WP_066030466.1 ATP-binding protein Regulator
  BEN31_RS01775 (BEN31_01775) comA 325919..326560 (+) 642 WP_060597210.1 response regulator transcription factor Regulator
  BEN31_RS01780 (BEN31_01780) - 326584..326973 (+) 390 WP_003213775.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=192157 BEN31_RS01760 WP_003213123.1 322099..322239(+) (degQ) [Bacillus pumilus strain PDSLzg-1]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=192157 BEN31_RS01760 WP_003213123.1 322099..322239(+) (degQ) [Bacillus pumilus strain PDSLzg-1]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment