Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   CAH07_RS05010 Genome accession   NZ_CP021123
Coordinates   983815..983955 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SEM-9     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 978815..988955
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CAH07_RS04980 (CAH07_04935) yueI 979109..979507 (+) 399 WP_015251331.1 YueI family protein -
  CAH07_RS04985 (CAH07_04940) pncA 979604..980155 (+) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  CAH07_RS04990 (CAH07_04945) pncB 980171..981643 (+) 1473 WP_041352162.1 nicotinate phosphoribosyltransferase -
  CAH07_RS04995 (CAH07_04950) pdeH 981780..983009 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  CAH07_RS05000 (CAH07_04955) - 982985..983353 (-) 369 WP_046381300.1 hypothetical protein -
  CAH07_RS05005 - 983468..983593 (-) 126 WP_003228793.1 hypothetical protein -
  CAH07_RS05010 (CAH07_04960) degQ 983815..983955 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  CAH07_RS05015 (CAH07_04965) comQ 984140..985003 (+) 864 WP_043858576.1 polyprenyl synthetase family protein Regulator
  CAH07_RS05020 (CAH07_04970) comX 985005..985226 (+) 222 WP_014480704.1 competence pheromone ComX -
  CAH07_RS05025 (CAH07_04975) comP 985242..987554 (+) 2313 WP_032722435.1 histidine kinase Regulator
  CAH07_RS05030 (CAH07_04980) comA 987635..988279 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  CAH07_RS05035 (CAH07_04985) yuxO 988298..988678 (+) 381 WP_017695528.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=190497 CAH07_RS05010 WP_003220708.1 983815..983955(+) (degQ) [Bacillus subtilis strain SEM-9]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=190497 CAH07_RS05010 WP_003220708.1 983815..983955(+) (degQ) [Bacillus subtilis strain SEM-9]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment