Detailed information NTG0190483

Bioinformatically predicted

Overview

• Name: pilC
• Type: Machinery gene
• Locus tag: A6L41_RS14620
• Genome accession: NZ_CP016655
• Coordinates: 1483282..1483407 (+)
• Length: 41 a.a.
• NCBI ID: WP_335582220.1
• Uniprot ID: -
• Organism: Neisseria meningitidis strain M22772
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1478282..1488407

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
A6L41_RS07595 (A6L41_07595)	hpaC	1478992..1479492 (-)	501	WP_002248346.1	4-hydroxyphenylacetate 3-monooxygenase, reductase component	-
A6L41_RS07600 (A6L41_07600)	nadR	1479607..1480047 (-)	441	WP_002221507.1	MarR family adhesin repressor NadR	-
A6L41_RS07610 (A6L41_07610)	-	1480390..1480899 (-)	510	WP_002225670.1	protein disulfide oxidoreductase	-
A6L41_RS07620 (A6L41_07620)	apbC	1481264..1482343 (+)	1080	WP_002248347.1	iron-sulfur cluster carrier protein ApbC	-
A6L41_RS14620	pilC	1483282..1483407 (+)	126	WP_335582220.1	hypothetical protein	Machinery gene
A6L41_RS07625 (A6L41_07625)	pilC	1483401..1486427 (+)	3027	WP_335582221.1	PilC family type IV pilus tip adhesin	Machinery gene

Sequence

Protein

• Length: 41 a.a.
• Molecular weight: 4556.42 Da
• Isoelectric Point: 12.6908

>NTDB_id=190483 A6L41_RS14620 WP_335582220.1 1483282..1483407(+) (pilC) [Neisseria meningitidis strain M22772]
MNKTLKRQVFRHTALYAAILMFSHTGGGGGGRRRKPITTLL

Nucleotide

• Length: 126 bp

>NTDB_id=190483 A6L41_RS14620 WP_335582220.1 1483282..1483407(+) (pilC) [Neisseria meningitidis strain M22772]
ATGAATAAAACTTTAAAAAGGCAGGTTTTCCGCCATACCGCGCTTTATGCCGCCATCTTGATGTTTTCCCATACCGGCGG
GGGGGGGGGGGGGCGCAGGCGGAAACCCATAACTACGCTATTGTAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilC	Neisseria meningitidis A1493	96.667	73.171	0.707