Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   BA204_RS12985 Genome accession   NZ_CP016595
Coordinates   2444381..2444659 (+) Length   92 a.a.
NCBI ID   WP_088911134.1    Uniprot ID   -
Organism   Bacillus cereus strain K8     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2433067..2475528 2444381..2444659 within 0


Gene organization within MGE regions


Location: 2433067..2475528
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BA204_RS12900 (BA204_12185) - 2433067..2433330 (+) 264 WP_002082716.1 DUF3937 domain-containing protein -
  BA204_RS12910 (BA204_12195) - 2433891..2434202 (+) 312 WP_001071359.1 heterocycloanthracin/sonorensin family bacteriocin -
  BA204_RS12915 (BA204_12200) - 2434604..2435065 (+) 462 WP_000358744.1 nucleoside 2-deoxyribosyltransferase -
  BA204_RS12920 - 2435079..2435261 (-) 183 Protein_2370 restriction endonuclease -
  BA204_RS30520 - 2435417..2435705 (+) 289 Protein_2371 hypothetical protein -
  BA204_RS30240 - 2435702..2435884 (+) 183 Protein_2372 hypothetical protein -
  BA204_RS30780 - 2436003..2436134 (+) 132 WP_000891530.1 hypothetical protein -
  BA204_RS12935 (BA204_12210) - 2436380..2437081 (+) 702 WP_000413143.1 DUF3962 domain-containing protein -
  BA204_RS12940 (BA204_12215) - 2437120..2438229 (-) 1110 WP_000675842.1 tyrosine-type recombinase/integrase -
  BA204_RS12945 (BA204_12220) - 2438533..2439735 (+) 1203 WP_088911132.1 exosporium leader peptide-containing protein -
  BA204_RS12950 (BA204_12225) - 2440377..2441528 (+) 1152 WP_000265308.1 AimR family lysis-lysogeny pheromone receptor -
  BA204_RS12955 (BA204_12230) - 2441566..2441712 (+) 147 WP_000720922.1 hypothetical protein -
  BA204_RS30785 - 2441866..2441994 (+) 129 WP_000836783.1 hypothetical protein -
  BA204_RS12960 (BA204_12235) - 2442032..2442385 (-) 354 WP_000491237.1 helix-turn-helix transcriptional regulator -
  BA204_RS12965 (BA204_12240) - 2442586..2442777 (+) 192 WP_000854268.1 helix-turn-helix transcriptional regulator -
  BA204_RS12970 (BA204_12245) - 2442834..2443100 (+) 267 WP_088911133.1 helix-turn-helix domain-containing protein -
  BA204_RS30245 - 2443100..2443264 (+) 165 WP_000390284.1 hypothetical protein -
  BA204_RS12980 (BA204_12250) - 2443322..2444377 (+) 1056 WP_001093547.1 DnaD domain protein -
  BA204_RS12985 (BA204_12255) abrB 2444381..2444659 (+) 279 WP_088911134.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  BA204_RS12990 (BA204_12260) - 2444652..2445011 (+) 360 WP_001125978.1 hypothetical protein -
  BA204_RS12995 (BA204_12265) - 2445030..2445197 (+) 168 WP_000717826.1 DUF3954 domain-containing protein -
  BA204_RS13000 (BA204_12270) - 2445223..2445474 (+) 252 WP_000109500.1 hypothetical protein -
  BA204_RS13005 (BA204_12275) - 2445494..2445975 (+) 482 Protein_2389 nucleoside triphosphate pyrophosphohydrolase family protein -
  BA204_RS30250 - 2446086..2446492 (-) 407 Protein_2390 DUF4870 domain-containing protein -
  BA204_RS13015 (BA204_12280) - 2446988..2447236 (-) 249 WP_000141882.1 hypothetical protein -
  BA204_RS29995 - 2447525..2447671 (-) 147 WP_154214170.1 hypothetical protein -
  BA204_RS13020 (BA204_12285) - 2449105..2449569 (-) 465 WP_001064727.1 hypothetical protein -
  BA204_RS30255 - 2450386..2450550 (-) 165 WP_000140900.1 hypothetical protein -
  BA204_RS13035 (BA204_12290) - 2450944..2451426 (+) 483 WP_000166170.1 ArpU family phage packaging/lysis transcriptional regulator -
  BA204_RS13040 (BA204_12295) - 2451426..2451968 (+) 543 WP_001012133.1 site-specific integrase -
  BA204_RS13045 (BA204_12300) - 2452182..2453132 (+) 951 WP_001170288.1 nucleoside hydrolase -
  BA204_RS13050 (BA204_12305) - 2453656..2454180 (+) 525 WP_000466453.1 AAA family ATPase -
  BA204_RS13070 (BA204_12315) - 2454952..2455173 (+) 222 WP_225321823.1 hypothetical protein -
  BA204_RS13075 (BA204_12320) - 2455180..2455437 (+) 258 WP_001089577.1 hypothetical protein -
  BA204_RS13080 (BA204_12325) - 2455430..2455765 (+) 336 WP_001008145.1 HNH endonuclease -
  BA204_RS13085 (BA204_12330) - 2455918..2456253 (+) 336 WP_088911135.1 P27 family phage terminase small subunit -
  BA204_RS13090 (BA204_12335) - 2456250..2457908 (+) 1659 WP_088911136.1 terminase TerL endonuclease subunit -
  BA204_RS13095 (BA204_12340) - 2457974..2459080 (+) 1107 WP_050552128.1 phage portal protein -
  BA204_RS13100 (BA204_12345) - 2459064..2459840 (+) 777 WP_000216404.1 head maturation protease, ClpP-related -
  BA204_RS13105 (BA204_12350) - 2459861..2461024 (+) 1164 WP_000234864.1 phage major capsid protein -
  BA204_RS13110 (BA204_12355) - 2461037..2461330 (+) 294 WP_000381904.1 hypothetical protein -
  BA204_RS13115 (BA204_12360) - 2461332..2461685 (+) 354 WP_001247277.1 phage head closure protein -
  BA204_RS13120 (BA204_12365) - 2461687..2462028 (+) 342 WP_088911137.1 HK97 gp10 family phage protein -
  BA204_RS13125 (BA204_12370) - 2462028..2462357 (+) 330 WP_000172092.1 hypothetical protein -
  BA204_RS13130 (BA204_12375) - 2462358..2462945 (+) 588 WP_001004914.1 major tail protein -
  BA204_RS13135 (BA204_12380) - 2462950..2463312 (+) 363 WP_000415919.1 hypothetical protein -
  BA204_RS30790 - 2463420..2463542 (+) 123 WP_257790385.1 hypothetical protein -
  BA204_RS13145 (BA204_12385) - 2463542..2464750 (+) 1209 Protein_2414 hypothetical protein -
  BA204_RS13150 (BA204_12390) - 2465007..2465264 (+) 258 WP_002098337.1 hypothetical protein -
  BA204_RS13155 (BA204_12395) - 2465487..2467652 (+) 2166 WP_088911139.1 phage tail tape measure protein -
  BA204_RS13160 (BA204_12400) - 2467694..2469157 (+) 1464 WP_000094129.1 distal tail protein Dit -
  BA204_RS13165 (BA204_12405) - 2469154..2473512 (+) 4359 WP_088911140.1 phage tail spike protein -
  BA204_RS13170 (BA204_12410) - 2473524..2473898 (+) 375 WP_000342977.1 hypothetical protein -
  BA204_RS13175 (BA204_12415) - 2473992..2474228 (+) 237 WP_000398738.1 hemolysin XhlA family protein -
  BA204_RS13180 (BA204_12420) - 2474228..2474467 (+) 240 WP_000461725.1 hypothetical protein -
  BA204_RS13185 (BA204_12425) - 2474464..2475528 (+) 1065 WP_088911141.1 N-acetylmuramoyl-L-alanine amidase -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 10096.72 Da        Isoelectric Point: 6.7190

>NTDB_id=189491 BA204_RS12985 WP_088911134.1 2444381..2444659(+) (abrB) [Bacillus cereus strain K8]
MKNTGVARKVDELGRVVIPVELRRTLGITEGTALDFHVGGENIVLRRHEKSCFVPGEVSENNIELLGGRMFLSKEGVIEL
LDLIQKSGMAHA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=189491 BA204_RS12985 WP_088911134.1 2444381..2444659(+) (abrB) [Bacillus cereus strain K8]
ATGAAAAACACGGGTGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
TATTACCGAAGGAACGGCACTAGATTTTCATGTCGGTGGTGAAAACATCGTTTTAAGAAGACATGAAAAGTCATGCTTTG
TACCGGGTGAAGTTTCTGAAAACAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGTAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(52-86)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-47)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

55.172

94.565

0.522

Multiple sequence alignment