Detailed information    

insolico Bioinformatically predicted

Overview

Name   amiF   Type   Regulator
Locus tag   A9497_RS03140 Genome accession   NZ_CP016026
Coordinates   622044..622973 (-) Length   309 a.a.
NCBI ID   WP_002951426.1    Uniprot ID   A0A7U7CIU5
Organism   Streptococcus thermophilus strain KLDS SM     
Function   internalize XIP (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 606513..677546 622044..622973 within 0


Gene organization within MGE regions


Location: 606513..677546
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A9497_RS03070 (A9497_03070) liaF 606521..607219 (-) 699 WP_011226289.1 cell wall-active antibiotics response protein LiaF -
  A9497_RS11265 - 607474..607641 (-) 168 WP_014608530.1 potassium channel family protein -
  A9497_RS03075 (A9497_03075) stkP/pknB 608279..610150 (-) 1872 WP_024703938.1 Stk1 family PASTA domain-containing Ser/Thr kinase Regulator
  A9497_RS03080 (A9497_03080) - 610150..610887 (-) 738 WP_002946881.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  A9497_RS03085 (A9497_03085) rsmB 610931..612253 (-) 1323 WP_014608533.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -
  A9497_RS03090 (A9497_03090) fmt 612243..613178 (-) 936 WP_014608534.1 methionyl-tRNA formyltransferase -
  A9497_RS03095 (A9497_03095) - 613196..615592 (-) 2397 WP_024703939.1 primosomal protein N' -
  A9497_RS03100 (A9497_03100) rpoZ 615734..616048 (-) 315 WP_002951415.1 DNA-directed RNA polymerase subunit omega -
  A9497_RS03105 (A9497_03105) gmk 616070..616699 (-) 630 WP_014608537.1 guanylate kinase -
  A9497_RS03110 (A9497_03110) ftsY 616925..618316 (-) 1392 WP_014608538.1 signal recognition particle-docking protein FtsY -
  A9497_RS03115 (A9497_03115) - 618330..619145 (-) 816 WP_011226298.1 Cof-type HAD-IIB family hydrolase -
  A9497_RS03120 (A9497_03120) - 619138..619932 (-) 795 WP_011681412.1 HAD-IIB family hydrolase -
  A9497_RS03125 (A9497_03125) - 620117..620494 (+) 378 WP_011681413.1 GntR family transcriptional regulator -
  A9497_RS03130 (A9497_03130) - 620499..621197 (+) 699 WP_023909821.1 ABC transporter ATP-binding protein -
  A9497_RS03135 (A9497_03135) - 621209..621994 (+) 786 WP_002951425.1 hypothetical protein -
  A9497_RS03140 (A9497_03140) amiF 622044..622973 (-) 930 WP_002951426.1 ATP-binding cassette domain-containing protein Regulator
  A9497_RS03145 (A9497_03145) amiE 622966..624051 (-) 1086 WP_011226304.1 ABC transporter ATP-binding protein Regulator
  A9497_RS03150 (A9497_03150) amiD 624061..624987 (-) 927 WP_002946409.1 oligopeptide ABC transporter permease OppC Regulator
  A9497_RS03155 (A9497_03155) amiC 624987..626480 (-) 1494 WP_011681416.1 ABC transporter permease Regulator
  A9497_RS03160 (A9497_03160) amiA 626542..628509 (-) 1968 WP_024703940.1 peptide ABC transporter substrate-binding protein Regulator
  A9497_RS03165 (A9497_03165) - 628865..630042 (+) 1178 Protein_618 ISL3 family transposase -
  A9497_RS03170 (A9497_03170) amiA3 630087..632060 (-) 1974 WP_011681419.1 peptide ABC transporter substrate-binding protein Regulator
  A9497_RS03180 (A9497_03180) - 632365..633512 (+) 1148 WP_095559415.1 IS3 family transposase -
  A9497_RS10110 - 633550..633734 (-) 185 Protein_621 IS3 family transposase -
  A9497_RS11270 - 633728..634138 (-) 411 Protein_622 ATP-binding cassette domain-containing protein -
  A9497_RS03190 (A9497_03190) - 634170..634484 (-) 315 Protein_623 TatD family hydrolase -
  A9497_RS03195 (A9497_03195) - 634830..636035 (+) 1206 WP_011681420.1 OFA family MFS transporter -
  A9497_RS10120 - 636081..637394 (-) 1314 Protein_625 IS3 family transposase -
  A9497_RS03210 (A9497_03210) pta 637519..638502 (-) 984 WP_011227420.1 phosphate acetyltransferase -
  A9497_RS03215 (A9497_03215) - 638516..639412 (-) 897 WP_024703943.1 RluA family pseudouridine synthase -
  A9497_RS03220 (A9497_03220) - 639409..640245 (-) 837 WP_014608552.1 NAD kinase -
  A9497_RS03225 (A9497_03225) - 640217..640891 (-) 675 WP_011681427.1 GTP pyrophosphokinase -
  A9497_RS03230 (A9497_03230) - 640987..641562 (+) 576 WP_002951444.1 CYTH domain-containing protein -
  A9497_RS03235 (A9497_03235) - 641925..642896 (+) 972 WP_002951446.1 ribose-phosphate diphosphokinase -
  A9497_RS03240 (A9497_03240) - 642900..644012 (+) 1113 WP_014608554.1 cysteine desulfurase family protein -
  A9497_RS03245 (A9497_03245) - 644014..644361 (+) 348 WP_014608555.1 DUF1831 domain-containing protein -
  A9497_RS03250 (A9497_03250) - 644505..645164 (+) 660 WP_024703944.1 redox-sensing transcriptional repressor Rex -
  A9497_RS03255 (A9497_03255) - 645157..645852 (+) 696 WP_024703945.1 gamma-glutamyl-gamma-aminobutyrate hydrolase family protein -
  A9497_RS03260 (A9497_03260) radC 645905..646591 (-) 687 WP_014727630.1 RadC family protein -
  A9497_RS03265 (A9497_03265) - 646640..648424 (-) 1785 WP_024703946.1 rhamnan synthesis F family protein -
  A9497_RS03270 (A9497_03270) - 648421..649488 (-) 1068 WP_024703947.1 glycosyltransferase family 2 protein -
  A9497_RS03275 (A9497_03275) - 649508..650713 (-) 1206 WP_014727633.1 ABC transporter ATP-binding protein -
  A9497_RS03280 (A9497_03280) - 650713..651522 (-) 810 WP_024703948.1 ABC transporter permease -
  A9497_RS03285 (A9497_03285) - 651506..652462 (-) 957 WP_024703949.1 glycosyltransferase family 2 protein -
  A9497_RS03290 (A9497_03290) cps2T 652459..653607 (-) 1149 WP_024703950.1 beta 1-4 rhamnosyltransferase Cps2T -
  A9497_RS03295 (A9497_03295) - 653714..655255 (-) 1542 WP_024703951.1 DUF2142 domain-containing protein -
  A9497_RS03300 (A9497_03300) - 655262..656272 (-) 1011 WP_024703952.1 glycosyltransferase -
  A9497_RS03305 (A9497_03305) - 656272..657546 (-) 1275 WP_024703953.1 lipopolysaccharide biosynthesis protein -
  A9497_RS03310 (A9497_03310) - 657539..657871 (-) 333 WP_011226332.1 DUF2304 domain-containing protein -
  A9497_RS03315 (A9497_03315) - 657877..658572 (-) 696 WP_024703954.1 glycosyltransferase family 2 protein -
  A9497_RS03320 (A9497_03320) rfbD 658649..659500 (-) 852 WP_014621820.1 dTDP-4-dehydrorhamnose reductase -
  A9497_RS03325 (A9497_03325) - 659577..660911 (-) 1335 WP_024703955.1 DUF3329 domain-containing protein -
  A9497_RS03330 (A9497_03330) - 661024..661950 (-) 927 WP_024703956.1 glycosyltransferase family 2 protein -
  A9497_RS03335 (A9497_03335) - 661960..662295 (-) 336 WP_024703957.1 metal-sulfur cluster assembly factor -
  A9497_RS10720 (A9497_03340) rpoD 662349..663458 (-) 1110 WP_011227440.1 RNA polymerase sigma factor RpoD -
  A9497_RS10725 (A9497_03345) dnaG 663462..665273 (-) 1812 WP_024703958.1 DNA primase -
  A9497_RS03350 (A9497_03350) mscL 665416..665496 (+) 81 Protein_654 large conductance mechanosensitive channel protein MscL -
  A9497_RS03355 (A9497_03355) rpsU 665656..665832 (-) 177 WP_011681449.1 30S ribosomal protein S21 -
  A9497_RS03360 (A9497_03360) - 666026..666820 (-) 795 WP_023909836.1 ABC transporter substrate-binding protein -
  A9497_RS03365 (A9497_03365) - 666882..667991 (-) 1110 WP_024703959.1 aminotransferase -
  A9497_RS03370 (A9497_03370) - 668339..669136 (-) 798 WP_014621828.1 transporter substrate-binding domain-containing protein -
  A9497_RS03375 (A9497_03375) - 669133..669963 (-) 831 WP_014621829.1 transporter substrate-binding domain-containing protein -
  A9497_RS03380 (A9497_03380) - 670177..670641 (-) 465 WP_011681454.1 8-oxo-dGTP diphosphatase -
  A9497_RS03385 (A9497_03385) uvrB 670686..672677 (-) 1992 WP_014608579.1 excinuclease ABC subunit UvrB -
  A9497_RS03390 (A9497_03390) - 672824..673291 (-) 468 WP_014608580.1 hypothetical protein -
  A9497_RS10130 - 673364..674300 (-) 937 Protein_663 CPBP family intramembrane glutamic endopeptidase -
  A9497_RS03405 (A9497_03405) - 674499..676709 (+) 2211 WP_014727645.1 ABC transporter substrate-binding protein/permease -
  A9497_RS03410 (A9497_03410) - 676709..677449 (+) 741 WP_024703961.1 amino acid ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 309 a.a.        Molecular weight: 35171.28 Da        Isoelectric Point: 6.5989

>NTDB_id=185366 A9497_RS03140 WP_002951426.1 622044..622973(-) (amiF) [Streptococcus thermophilus strain KLDS SM]
MPEKLVEVKDVEISFGEGRKKFVAVHNANFFINKGETFSLVGESGSGKTTIGRAIIGLNDTSNGEIIFDGKKINGYLSHS
EKNDLIRRIQMIFQDPAASLNERATVDYILSEGLYNFHLYKDEEERKAKIKEIIKEVGLLEEHLTRYPHEFSGGQRQRIG
IARSLVMQPDLVIADEPISALDVSVRAQVLNLLKKFQKELGLTYLFIAHDLSVVRFISDRIAVIYKGTIVEVAETEELYN
NPIHPYTKSLLSAVPIPDPILERKKVLKVYDPNQHDYSVDKPEMVEVRPGHFVWGNKTEIETYRKEQSK

Nucleotide


Download         Length: 930 bp        

>NTDB_id=185366 A9497_RS03140 WP_002951426.1 622044..622973(-) (amiF) [Streptococcus thermophilus strain KLDS SM]
ATGCCTGAGAAATTAGTTGAAGTAAAAGATGTGGAAATTTCCTTCGGCGAAGGAAGAAAGAAGTTCGTTGCTGTCCACAA
TGCTAATTTTTTCATCAACAAGGGTGAAACCTTCTCCCTCGTTGGTGAGTCTGGTAGTGGTAAAACGACTATTGGACGTG
CCATTATCGGTTTAAATGACACAAGTAATGGTGAGATTATTTTTGACGGTAAGAAGATCAATGGATACTTATCTCACTCT
GAGAAAAACGACCTTATCCGTCGTATTCAGATGATTTTCCAAGACCCTGCGGCTAGTTTGAATGAACGTGCGACAGTCGA
TTATATCTTGTCTGAGGGCTTGTACAATTTCCATCTTTATAAAGATGAGGAAGAACGTAAGGCTAAAATCAAGGAAATCA
TCAAAGAAGTAGGACTTCTTGAGGAGCACTTAACACGTTACCCTCACGAATTTTCTGGGGGACAACGTCAACGTATCGGG
ATTGCGCGTTCTTTGGTCATGCAGCCTGATTTGGTTATCGCTGATGAACCAATCTCAGCCCTTGACGTGTCAGTTCGTGC
CCAAGTTTTGAATTTGCTTAAGAAATTCCAAAAAGAGTTGGGGTTAACCTATCTCTTTATCGCTCACGATTTGTCAGTGG
TCCGTTTCATTTCTGATCGTATCGCTGTTATCTATAAGGGGACAATCGTGGAAGTTGCTGAGACAGAAGAGCTCTACAAC
AATCCTATCCATCCTTACACCAAGTCACTCTTGTCTGCTGTTCCTATTCCAGATCCAATCTTGGAACGTAAGAAAGTCTT
GAAGGTTTATGATCCAAACCAACACGACTATTCGGTTGATAAACCAGAAATGGTGGAAGTACGCCCAGGTCACTTCGTTT
GGGGTAACAAGACAGAAATTGAGACTTATCGTAAAGAACAAAGTAAGTAA

Domains

Predicted by InterproScan.

ABC transporter (ABC_tran)

(26-178)

Oligopeptide/dipeptide transporter, C-terminal region (oligo_HPY)

(230-262)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A7U7CIU5

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  amiF Streptococcus thermophilus LMG 18311

100

100

1
  amiF Streptococcus thermophilus LMD-9

99.676

100

0.997
  amiF Streptococcus salivarius strain HSISS4

98.058

100

0.981

Multiple sequence alignment