Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   B4U62_RS13300 Genome accession   NZ_CP020102
Coordinates   2552467..2552640 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain NCIB 3610     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2547467..2557640
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B4U62_RS13285 (B4U62_13285) gcvT 2548266..2549354 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  B4U62_RS13290 (B4U62_13290) hepAA 2549796..2551469 (+) 1674 WP_004398544.1 SNF2-related protein -
  B4U62_RS13295 (B4U62_13295) yqhG 2551490..2552284 (+) 795 WP_003230200.1 YqhG family protein -
  B4U62_RS13300 (B4U62_13300) sinI 2552467..2552640 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  B4U62_RS13305 (B4U62_13305) sinR 2552674..2553009 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  B4U62_RS13310 (B4U62_13310) tasA 2553102..2553887 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  B4U62_RS13315 (B4U62_13315) sipW 2553951..2554523 (-) 573 WP_003246088.1 signal peptidase I SipW -
  B4U62_RS13320 (B4U62_13320) tapA 2554507..2555268 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  B4U62_RS13325 (B4U62_13325) yqzG 2555540..2555866 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  B4U62_RS13330 (B4U62_13330) spoIITA 2555908..2556087 (-) 180 WP_003230176.1 YqzE family protein -
  B4U62_RS13335 (B4U62_13335) comGG 2556158..2556532 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  B4U62_RS13340 (B4U62_13340) comGF 2556533..2556916 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  B4U62_RS13345 (B4U62_13345) comGE 2556942..2557289 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=184867 B4U62_RS13300 WP_003230187.1 2552467..2552640(+) (sinI) [Bacillus subtilis strain NCIB 3610]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=184867 B4U62_RS13300 WP_003230187.1 2552467..2552640(+) (sinI) [Bacillus subtilis strain NCIB 3610]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment