Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | B4U62_RS13300 | Genome accession | NZ_CP020102 |
| Coordinates | 2552467..2552640 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0ABU0V3E4 |
| Organism | Bacillus subtilis strain NCIB 3610 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2547467..2557640
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B4U62_RS13285 (B4U62_13285) | gcvT | 2548266..2549354 (-) | 1089 | WP_004398598.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| B4U62_RS13290 (B4U62_13290) | hepAA | 2549796..2551469 (+) | 1674 | WP_004398544.1 | SNF2-related protein | - |
| B4U62_RS13295 (B4U62_13295) | yqhG | 2551490..2552284 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| B4U62_RS13300 (B4U62_13300) | sinI | 2552467..2552640 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| B4U62_RS13305 (B4U62_13305) | sinR | 2552674..2553009 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| B4U62_RS13310 (B4U62_13310) | tasA | 2553102..2553887 (-) | 786 | WP_004398632.1 | biofilm matrix protein TasA | - |
| B4U62_RS13315 (B4U62_13315) | sipW | 2553951..2554523 (-) | 573 | WP_003246088.1 | signal peptidase I SipW | - |
| B4U62_RS13320 (B4U62_13320) | tapA | 2554507..2555268 (-) | 762 | WP_004399106.1 | amyloid fiber anchoring/assembly protein TapA | - |
| B4U62_RS13325 (B4U62_13325) | yqzG | 2555540..2555866 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| B4U62_RS13330 (B4U62_13330) | spoIITA | 2555908..2556087 (-) | 180 | WP_003230176.1 | YqzE family protein | - |
| B4U62_RS13335 (B4U62_13335) | comGG | 2556158..2556532 (-) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| B4U62_RS13340 (B4U62_13340) | comGF | 2556533..2556916 (-) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| B4U62_RS13345 (B4U62_13345) | comGE | 2556942..2557289 (-) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=184867 B4U62_RS13300 WP_003230187.1 2552467..2552640(+) (sinI) [Bacillus subtilis strain NCIB 3610]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=184867 B4U62_RS13300 WP_003230187.1 2552467..2552640(+) (sinI) [Bacillus subtilis strain NCIB 3610]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |