Detailed information    

insolico Bioinformatically predicted

Overview

Name   rocC   Type   Regulator
Locus tag   A9E79_RS00675 Genome accession   NZ_CP015934
Coordinates   155787..156479 (+) Length   230 a.a.
NCBI ID   WP_010945894.1    Uniprot ID   Q5ZZ78
Organism   Legionella pneumophila strain C3_O     
Function   rocR chaperone; repress natural transformation (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 138804..206244 155787..156479 within 0


Gene organization within MGE regions


Location: 138804..206244
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A9E79_RS00620 (A9E79_00620) - 140195..141493 (+) 1299 WP_010945883.1 AAA-associated domain-containing protein -
  A9E79_RS00625 (A9E79_00625) - 141570..142184 (-) 615 WP_015444948.1 thiol:disulfide interchange protein DsbA/DsbL -
  A9E79_RS00630 (A9E79_00630) - 142195..142797 (-) 603 WP_010945885.1 c-type cytochrome -
  A9E79_RS00635 (A9E79_00635) yihA 142872..143474 (+) 603 WP_010945886.1 ribosome biogenesis GTP-binding protein YihA/YsxC -
  A9E79_RS00640 (A9E79_00640) cegC2 143588..146896 (+) 3309 WP_010945887.1 Dot/Icm T4SS effector CegC2 -
  A9E79_RS00645 (A9E79_00645) acs 146993..148876 (-) 1884 WP_010945888.1 acetate--CoA ligase -
  A9E79_RS00650 (A9E79_00650) mmsB 148878..149774 (-) 897 WP_015444947.1 3-hydroxyisobutyrate dehydrogenase -
  A9E79_RS00655 (A9E79_00655) - 149798..151297 (-) 1500 WP_015444946.1 CoA-acylating methylmalonate-semialdehyde dehydrogenase -
  A9E79_RS15385 - 151408..151584 (-) 177 WP_014840774.1 dodecin domain-containing protein -
  A9E79_RS00660 (A9E79_00660) - 151762..154230 (+) 2469 WP_010945891.1 hypothetical protein -
  A9E79_RS00665 (A9E79_00665) dapB 154334..155065 (-) 732 WP_010945892.1 4-hydroxy-tetrahydrodipicolinate reductase -
  A9E79_RS00670 (A9E79_00670) - 155245..155430 (-) 186 WP_010945893.1 hypothetical protein -
  A9E79_RS00675 (A9E79_00675) rocC 155787..156479 (+) 693 WP_010945894.1 ProQ/FinO family protein Regulator
  A9E79_RS00680 (A9E79_00680) - 156480..157550 (+) 1071 WP_010945895.1 hypothetical protein -
  A9E79_RS00685 (A9E79_00685) sdhB 157650..163277 (-) 5628 WP_010945896.1 Dot/Icm T4SS effector SdhB -
  A9E79_RS00690 (A9E79_00690) pyk 163368..164792 (-) 1425 WP_010945897.1 pyruvate kinase -
  A9E79_RS00695 (A9E79_00695) - 164776..165966 (-) 1191 WP_010945898.1 phosphoglycerate kinase -
  A9E79_RS00700 (A9E79_00700) gap 165977..166969 (-) 993 WP_015444943.1 type I glyceraldehyde-3-phosphate dehydrogenase -
  A9E79_RS00705 (A9E79_00705) tkt 167051..169129 (-) 2079 WP_010945900.1 transketolase -
  A9E79_RS00710 (A9E79_00710) - 169315..170649 (+) 1335 WP_010945901.1 hypothetical protein -
  A9E79_RS00715 (A9E79_00715) - 170748..172763 (+) 2016 WP_015444939.1 M3 family metallopeptidase -
  A9E79_RS00725 (A9E79_00725) - 173349..174017 (-) 669 WP_038836939.1 hypothetical protein -
  A9E79_RS00730 (A9E79_00730) - 174062..175255 (-) 1194 WP_038836942.1 tyrosine-type recombinase/integrase -
  A9E79_RS15390 - 175201..175410 (-) 210 WP_072401522.1 excisionase -
  A9E79_RS15945 - 175546..175752 (+) 207 WP_154213629.1 hypothetical protein -
  A9E79_RS00740 (A9E79_00740) - 175849..176496 (+) 648 WP_038836947.1 LexA family transcriptional regulator -
  A9E79_RS00745 (A9E79_00745) - 176513..176872 (+) 360 WP_028385432.1 hypothetical protein -
  A9E79_RS00750 (A9E79_00750) - 176865..178295 (+) 1431 WP_038836949.1 VUT family protein -
  A9E79_RS00755 (A9E79_00755) - 178288..178749 (+) 462 WP_038836952.1 nucleoside deaminase -
  A9E79_RS00760 (A9E79_00760) - 178772..179497 (-) 726 WP_050566894.1 hypothetical protein -
  A9E79_RS00765 (A9E79_00765) - 179531..179806 (-) 276 WP_038836954.1 conjugal transfer protein TraD -
  A9E79_RS00770 (A9E79_00770) - 179793..179999 (-) 207 WP_038836956.1 hypothetical protein -
  A9E79_RS00775 (A9E79_00775) traA 180174..182897 (+) 2724 WP_309473570.1 Ti-type conjugative transfer relaxase TraA -
  A9E79_RS00780 (A9E79_00780) - 183114..183806 (+) 693 WP_040148287.1 hypothetical protein -
  A9E79_RS00785 (A9E79_00785) - 183948..184745 (-) 798 WP_038836972.1 DUF1566 domain-containing protein -
  A9E79_RS00790 (A9E79_00790) - 184844..186685 (-) 1842 WP_070065716.1 type IV secretory system conjugative DNA transfer family protein -
  A9E79_RS00795 (A9E79_00795) virB11 186738..187742 (-) 1005 WP_038836977.1 P-type DNA transfer ATPase VirB11 -
  A9E79_RS00800 (A9E79_00800) - 187744..188835 (-) 1092 WP_038836979.1 TrbI/VirB10 family protein -
  A9E79_RS00805 (A9E79_00805) virB9 188832..189584 (-) 753 WP_038836980.1 P-type conjugative transfer protein VirB9 -
  A9E79_RS00810 (A9E79_00810) - 189581..190297 (-) 717 WP_038836981.1 virB8 family protein -
  A9E79_RS00815 (A9E79_00815) - 190294..191334 (-) 1041 WP_038836985.1 type IV secretion system protein -
  A9E79_RS00820 (A9E79_00820) lvrD 191338..191733 (-) 396 WP_038836988.1 T4SS-associated protein LvrD -
  A9E79_RS15395 lvhB7 191730..191876 (-) 147 WP_011212804.1 T4SS-associated protein LvhB7 -
  A9E79_RS00825 (A9E79_00825) - 191891..192601 (-) 711 WP_038836990.1 type IV secretion system protein -
  A9E79_RS00830 (A9E79_00830) - 192598..195078 (-) 2481 WP_038836992.1 VirB4 family type IV secretion/conjugal transfer ATPase -
  A9E79_RS00835 (A9E79_00835) - 195065..195346 (-) 282 WP_011214430.1 type IV secretion system protein VirB3 -
  A9E79_RS00840 (A9E79_00840) - 195356..195646 (-) 291 WP_014843090.1 TrbC/VirB2 family protein -
  A9E79_RS00845 (A9E79_00845) - 195643..195846 (-) 204 WP_038836996.1 carbon storage regulator -
  A9E79_RS00850 (A9E79_00850) - 195859..196221 (-) 363 WP_050566896.1 hypothetical protein -
  A9E79_RS15995 (A9E79_00855) - 196187..197056 (-) 870 WP_038836999.1 hypothetical protein -
  A9E79_RS00860 (A9E79_00860) - 197211..197894 (+) 684 WP_080124627.1 helix-turn-helix domain-containing protein -
  A9E79_RS00865 (A9E79_00865) - 197884..198615 (-) 732 WP_038837001.1 M48 family metallopeptidase -
  A9E79_RS00870 (A9E79_00870) - 198629..201901 (-) 3273 WP_038837003.1 type I restriction endonuclease subunit R -
  A9E79_RS00875 (A9E79_00875) - 201898..203805 (-) 1908 WP_038837006.1 RNA-binding domain-containing protein -
  A9E79_RS16090 - 203959..204093 (-) 135 WP_225972262.1 DUF2188 domain-containing protein -
  A9E79_RS00885 (A9E79_00885) - 204112..205344 (-) 1233 WP_040148278.1 restriction endonuclease subunit S -

Sequence

Protein


Download         Length: 230 a.a.        Molecular weight: 25741.65 Da        Isoelectric Point: 10.7030

>NTDB_id=183990 A9E79_RS00675 WP_010945894.1 155787..156479(+) (rocC) [Legionella pneumophila strain C3_O]
MRKQALHPRTAVINKAQKNQSKRARSDALLWLAANFPEAFDNSLRIRPLKIGIMSDILQHAEKAEQVGISKSKLREAVVL
FTRRLDYLACLKAREVRIDLHGNPVAEVTEEEAEHASMKIKKRVEKSVKNARKQVNAKAANHSHVNSQPSAVSSVKPMNS
FDSHPEPLLPIYPLRSSTYASQNVAMQSAKSPSVVVKHKAPKQYDPDAVARLKEKLGLSRKAEEKKETTE

Nucleotide


Download         Length: 693 bp        

>NTDB_id=183990 A9E79_RS00675 WP_010945894.1 155787..156479(+) (rocC) [Legionella pneumophila strain C3_O]
ATGAGAAAGCAGGCGCTGCACCCACGAACCGCTGTCATCAATAAAGCACAAAAAAATCAATCCAAGCGAGCGCGATCTGA
CGCATTATTATGGCTTGCGGCTAATTTCCCTGAGGCATTCGATAATTCTTTGCGTATTCGGCCATTAAAGATTGGTATTA
TGTCTGATATATTGCAGCATGCAGAAAAAGCAGAGCAAGTTGGAATTTCTAAAAGTAAATTAAGGGAAGCTGTTGTTCTT
TTTACCCGTCGTCTTGATTATCTGGCTTGCCTGAAAGCTCGTGAAGTCCGTATTGATTTGCACGGAAATCCAGTAGCCGA
GGTTACTGAGGAAGAAGCTGAGCATGCTTCCATGAAAATTAAAAAACGCGTGGAAAAGAGTGTTAAAAATGCTCGCAAAC
AAGTGAATGCAAAAGCGGCTAATCATTCGCATGTAAATAGTCAGCCAAGTGCAGTTTCCAGCGTTAAGCCAATGAATTCG
TTTGACTCTCATCCTGAGCCTCTTTTGCCAATATATCCTCTCAGAAGCTCTACCTATGCCTCACAAAATGTGGCAATGCA
ATCCGCCAAGTCACCATCCGTCGTAGTCAAACATAAAGCACCAAAGCAATATGATCCGGATGCTGTAGCCCGTTTAAAAG
AAAAATTAGGATTGTCTCGAAAAGCAGAAGAGAAAAAGGAAACAACAGAGTAA

Domains

Predicted by InterproScan.

ProQ/FINO family (ProQ)

(26-132)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q5ZZ78

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  rocC Legionella pneumophila str. Paris

97.391

100

0.974

Multiple sequence alignment