Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BS21228_RS03000 | Genome accession | NZ_CP020023 |
| Coordinates | 527258..527431 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0ABU0V3E4 |
| Organism | Bacillus subtilis strain ATCC 21228 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 522258..532431
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BS21228_RS02985 (BS21228_02950) | gcvT | 523057..524145 (-) | 1089 | WP_014480247.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BS21228_RS02990 (BS21228_02955) | hepAA | 524587..526260 (+) | 1674 | WP_014480248.1 | SNF2-related protein | - |
| BS21228_RS02995 (BS21228_02960) | yqhG | 526281..527075 (+) | 795 | WP_014480249.1 | YqhG family protein | - |
| BS21228_RS03000 (BS21228_02965) | sinI | 527258..527431 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| BS21228_RS03005 (BS21228_02970) | sinR | 527465..527800 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| BS21228_RS03010 (BS21228_02975) | tasA | 527893..528678 (-) | 786 | WP_014480250.1 | biofilm matrix protein TasA | - |
| BS21228_RS03015 (BS21228_02980) | sipW | 528742..529314 (-) | 573 | WP_003230181.1 | signal peptidase I SipW | - |
| BS21228_RS03020 (BS21228_02985) | tapA | 529298..530059 (-) | 762 | WP_014480251.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BS21228_RS03025 (BS21228_02990) | yqzG | 530331..530657 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| BS21228_RS03030 (BS21228_02995) | spoIITA | 530699..530878 (-) | 180 | WP_014480252.1 | YqzE family protein | - |
| BS21228_RS03035 (BS21228_03000) | comGG | 530949..531323 (-) | 375 | WP_014480253.1 | ComG operon protein ComGG | Machinery gene |
| BS21228_RS03040 (BS21228_03005) | comGF | 531324..531707 (-) | 384 | WP_014480254.1 | ComG operon protein ComGF | Machinery gene |
| BS21228_RS03045 (BS21228_03010) | comGE | 531733..532080 (-) | 348 | WP_014480255.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=183692 BS21228_RS03000 WP_003230187.1 527258..527431(+) (sinI) [Bacillus subtilis strain ATCC 21228]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=183692 BS21228_RS03000 WP_003230187.1 527258..527431(+) (sinI) [Bacillus subtilis strain ATCC 21228]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |