Detailed information
Overview
| Name | comGG | Type | Machinery gene |
| Locus tag | LLUL8_RS11255 | Genome accession | NZ_CP015908 |
| Coordinates | 2193392..2193718 (-) | Length | 108 a.a. |
| NCBI ID | WP_058221568.1 | Uniprot ID | - |
| Organism | Lactococcus lactis subsp. lactis strain UL8 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2191827..2228453 | 2193392..2193718 | within | 0 |
Gene organization within MGE regions
Location: 2191827..2228453
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLUL8_RS11245 (LLUL8_2191) | - | 2191827..2192264 (-) | 438 | WP_003129992.1 | zinc-dependent MarR family transcriptional regulator | - |
| LLUL8_RS11250 (LLUL8_2192) | - | 2192471..2193418 (+) | 948 | WP_003130410.1 | IS30 family transposase | - |
| LLUL8_RS11255 | comGG | 2193392..2193718 (-) | 327 | WP_058221568.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LLUL8_RS11260 (LLUL8_2193) | comGF | 2193768..2194196 (-) | 429 | Protein_2175 | competence type IV pilus minor pilin ComGF | - |
| LLUL8_RS11265 (LLUL8_2194) | comGE | 2194159..2194455 (-) | 297 | WP_010906316.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LLUL8_RS11270 (LLUL8_2195) | comGD | 2194427..2194858 (-) | 432 | WP_080585155.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| LLUL8_RS11275 (LLUL8_2196) | comGC | 2194818..2195087 (-) | 270 | WP_003129998.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LLUL8_RS11280 (LLUL8_2197) | - | 2195214..2195906 (-) | 693 | WP_152994386.1 | hypothetical protein | - |
| LLUL8_RS11285 (LLUL8_2198) | - | 2196148..2196927 (-) | 780 | WP_082225220.1 | peptidoglycan amidohydrolase family protein | - |
| LLUL8_RS11290 (LLUL8_2199) | - | 2196927..2197226 (-) | 300 | WP_031559226.1 | phage holin | - |
| LLUL8_RS11295 (LLUL8_2200) | - | 2197239..2197589 (-) | 351 | WP_014570798.1 | hypothetical protein | - |
| LLUL8_RS11300 (LLUL8_2201) | - | 2197602..2197838 (-) | 237 | WP_082225257.1 | hypothetical protein | - |
| LLUL8_RS11305 (LLUL8_2202) | - | 2197850..2200699 (-) | 2850 | WP_237024042.1 | phage tail protein | - |
| LLUL8_RS11310 (LLUL8_2203) | - | 2200678..2202207 (-) | 1530 | WP_003131327.1 | distal tail protein Dit | - |
| LLUL8_RS11315 (LLUL8_2204) | - | 2202217..2204826 (-) | 2610 | WP_058221395.1 | phage tail tape measure protein | - |
| LLUL8_RS11320 (LLUL8_2205) | - | 2204816..2205523 (-) | 708 | WP_003131324.1 | Gp15 family bacteriophage protein | - |
| LLUL8_RS11325 (LLUL8_2206) | - | 2205539..2205946 (-) | 408 | WP_058221396.1 | hypothetical protein | - |
| LLUL8_RS11330 (LLUL8_2207) | - | 2206003..2206479 (-) | 477 | WP_014570559.1 | hypothetical protein | - |
| LLUL8_RS11335 (LLUL8_2208) | - | 2206490..2206924 (-) | 435 | WP_003131321.1 | minor capsid protein | - |
| LLUL8_RS11340 (LLUL8_2209) | - | 2206924..2207253 (-) | 330 | WP_003131320.1 | hypothetical protein | - |
| LLUL8_RS11345 (LLUL8_2210) | - | 2207250..2207594 (-) | 345 | WP_014570557.1 | putative minor capsid protein | - |
| LLUL8_RS11350 (LLUL8_2211) | - | 2207584..2207985 (-) | 402 | WP_014570556.1 | hypothetical protein | - |
| LLUL8_RS11355 (LLUL8_2212) | - | 2208059..2208295 (-) | 237 | WP_014570555.1 | Ig-like domain-containing protein | - |
| LLUL8_RS11360 (LLUL8_2213) | - | 2208324..2209241 (-) | 918 | WP_003131315.1 | hypothetical protein | - |
| LLUL8_RS11365 (LLUL8_2214) | - | 2209256..2210305 (-) | 1050 | WP_003131314.1 | XkdF-like putative serine protease domain-containing protein | - |
| LLUL8_RS11370 (LLUL8_2215) | - | 2210321..2211151 (-) | 831 | WP_003131311.1 | phage minor head protein | - |
| LLUL8_RS11375 (LLUL8_2216) | - | 2211144..2212673 (-) | 1530 | WP_058221397.1 | phage portal protein | - |
| LLUL8_RS11380 (LLUL8_2217) | terL | 2212686..2214128 (-) | 1443 | WP_124156151.1 | phage terminase large subunit | - |
| LLUL8_RS11385 (LLUL8_2218) | - | 2214118..2214591 (-) | 474 | WP_058221398.1 | transposase | - |
| LLUL8_RS11390 (LLUL8_2219) | - | 2214762..2215151 (-) | 390 | WP_058221399.1 | DUF722 domain-containing protein | - |
| LLUL8_RS11395 (LLUL8_2220) | - | 2215228..2215536 (-) | 309 | WP_082225258.1 | hypothetical protein | - |
| LLUL8_RS11400 (LLUL8_2221) | - | 2215665..2215880 (-) | 216 | WP_058221541.1 | DUF1660 domain-containing protein | - |
| LLUL8_RS11405 (LLUL8_2222) | - | 2215877..2216095 (-) | 219 | WP_014570803.1 | hypothetical protein | - |
| LLUL8_RS11410 (LLUL8_2223) | - | 2216114..2216833 (-) | 720 | WP_082225259.1 | hypothetical protein | - |
| LLUL8_RS11415 (LLUL8_2224) | - | 2216860..2217219 (-) | 360 | WP_082225260.1 | hypothetical protein | - |
| LLUL8_RS11420 (LLUL8_2225) | dut | 2217223..2217642 (-) | 420 | WP_082225261.1 | dUTP diphosphatase | - |
| LLUL8_RS13200 (LLUL8_2226) | - | 2217639..2218004 (-) | 366 | WP_082225262.1 | DUF1642 domain-containing protein | - |
| LLUL8_RS11430 (LLUL8_2227) | - | 2218001..2218543 (-) | 543 | WP_145952586.1 | DUF1642 domain-containing protein | - |
| LLUL8_RS13205 (LLUL8_2228) | - | 2218536..2218694 (-) | 159 | WP_228763263.1 | hypothetical protein | - |
| LLUL8_RS13210 (LLUL8_2229) | - | 2218737..2218895 (-) | 159 | WP_228763273.1 | hypothetical protein | - |
| LLUL8_RS11450 (LLUL8_2231) | - | 2219401..2219811 (-) | 411 | WP_014570810.1 | hypothetical protein | - |
| LLUL8_RS11455 (LLUL8_2232) | - | 2219824..2220096 (-) | 273 | WP_145952588.1 | L-rhamnose isomerase | - |
| LLUL8_RS12860 (LLUL8_2233) | - | 2220059..2220220 (-) | 162 | WP_158521330.1 | hypothetical protein | - |
| LLUL8_RS11460 (LLUL8_2234) | - | 2220259..2221185 (-) | 927 | WP_058221710.1 | phage replisome organizer N-terminal domain-containing protein | - |
| LLUL8_RS11465 (LLUL8_2235) | - | 2221448..2222515 (-) | 1068 | WP_058221711.1 | DUF1351 domain-containing protein | - |
| LLUL8_RS11470 (LLUL8_2236) | bet | 2222517..2223254 (-) | 738 | WP_058212836.1 | phage recombination protein Bet | - |
| LLUL8_RS11475 (LLUL8_2237) | - | 2223361..2223537 (-) | 177 | WP_032943269.1 | putative transcriptional regulator | - |
| LLUL8_RS11480 (LLUL8_2238) | - | 2223534..2223782 (-) | 249 | WP_058221712.1 | hypothetical protein | - |
| LLUL8_RS13285 (LLUL8_2239) | - | 2223795..2223917 (-) | 123 | WP_023164646.1 | hypothetical protein | - |
| LLUL8_RS11485 (LLUL8_2240) | - | 2223914..2224096 (-) | 183 | WP_003130605.1 | hypothetical protein | - |
| LLUL8_RS11490 (LLUL8_2241) | - | 2224112..2224801 (-) | 690 | WP_058221713.1 | Rha family transcriptional regulator | - |
| LLUL8_RS11495 (LLUL8_2242) | - | 2224860..2225093 (-) | 234 | WP_014570819.1 | transcriptional regulator | - |
| LLUL8_RS11500 (LLUL8_2243) | - | 2225270..2225680 (+) | 411 | WP_014570820.1 | helix-turn-helix transcriptional regulator | - |
| LLUL8_RS11505 (LLUL8_2244) | - | 2225691..2226275 (+) | 585 | WP_058221714.1 | hypothetical protein | - |
| LLUL8_RS11510 (LLUL8_2245) | - | 2226331..2226870 (+) | 540 | WP_023189015.1 | PH domain-containing protein | - |
| LLUL8_RS11515 (LLUL8_2246) | - | 2226996..2228453 (+) | 1458 | WP_058221720.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 108 a.a. Molecular weight: 12234.69 Da Isoelectric Point: 6.0669
>NTDB_id=183382 LLUL8_RS11255 WP_058221568.1 2193392..2193718(-) (comGG) [Lactococcus lactis subsp. lactis strain UL8]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGANFQIKNANCKSKLASQAHLI
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGANFQIKNANCKSKLASQAHLI
Nucleotide
Download Length: 327 bp
>NTDB_id=183382 LLUL8_RS11255 WP_058221568.1 2193392..2193718(-) (comGG) [Lactococcus lactis subsp. lactis strain UL8]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAACGCAAATTGCAAGTCCAAGTTAGCCAGCCAAGCTCATCT
CATATGA
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAACGCAAATTGCAAGTCCAAGTTAGCCAGCCAAGCTCATCT
CATATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGG | Lactococcus lactis subsp. cremoris KW2 |
58.065 |
86.111 |
0.5 |