Detailed information
Overview
| Name | comGG | Type | Machinery gene |
| Locus tag | LLUC77_RS11940 | Genome accession | NZ_CP015906 |
| Coordinates | 2307013..2307297 (-) | Length | 94 a.a. |
| NCBI ID | WP_010906314.1 | Uniprot ID | A0AAC9R304 |
| Organism | Lactococcus lactis subsp. lactis strain UC77 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2304742..2352170 | 2307013..2307297 | within | 0 |
Gene organization within MGE regions
Location: 2304742..2352170
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLUC77_RS11925 (LLUC77_2359) | - | 2304742..2305479 (-) | 738 | WP_010906311.1 | metal ABC transporter ATP-binding protein | - |
| LLUC77_RS11930 (LLUC77_2360) | - | 2305656..2306498 (-) | 843 | WP_010906312.1 | metal ABC transporter substrate-binding protein | - |
| LLUC77_RS11935 (LLUC77_2361) | - | 2306495..2306932 (-) | 438 | WP_010906313.1 | zinc-dependent MarR family transcriptional regulator | - |
| LLUC77_RS11940 (LLUC77_2362) | comGG | 2307013..2307297 (-) | 285 | WP_010906314.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LLUC77_RS11945 (LLUC77_2363) | comGF | 2307336..2307782 (-) | 447 | WP_031296844.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LLUC77_RS11950 (LLUC77_2364) | comGE | 2307745..2308041 (-) | 297 | WP_010906316.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LLUC77_RS11955 (LLUC77_2365) | comGD | 2308013..2308411 (-) | 399 | WP_021214886.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| LLUC77_RS11960 (LLUC77_2366) | comGC | 2308404..2308673 (-) | 270 | WP_023349160.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LLUC77_RS11965 (LLUC77_03470) | - | 2308834..2309571 (-) | 738 | WP_081172231.1 | hypothetical protein | - |
| LLUC77_RS11970 (LLUC77_03475) | - | 2309775..2310554 (-) | 780 | WP_081172233.1 | peptidoglycan amidohydrolase family protein | - |
| LLUC77_RS11975 (LLUC77_03480) | - | 2310554..2310841 (-) | 288 | WP_023164507.1 | phage holin | - |
| LLUC77_RS11980 (LLUC77_03485) | - | 2310828..2311154 (-) | 327 | WP_010905389.1 | hypothetical protein | - |
| LLUC77_RS11985 (LLUC77_03490) | - | 2311174..2317230 (-) | 6057 | WP_250362969.1 | hypothetical protein | - |
| LLUC77_RS11990 (LLUC77_03495) | - | 2317208..2317381 (-) | 174 | WP_081172169.1 | hypothetical protein | - |
| LLUC77_RS11995 (LLUC77_03500) | - | 2317381..2318502 (-) | 1122 | WP_250362970.1 | hypothetical protein | - |
| LLUC77_RS12000 (LLUC77_03505) | - | 2318518..2320305 (-) | 1788 | WP_081172173.1 | phage tail protein | - |
| LLUC77_RS12005 (LLUC77_03510) | - | 2320305..2321840 (-) | 1536 | WP_081172175.1 | distal tail protein Dit | - |
| LLUC77_RS12010 (LLUC77_03515) | - | 2321843..2326972 (-) | 5130 | WP_081172177.1 | phage tail tape measure protein | - |
| LLUC77_RS12015 (LLUC77_03520) | - | 2327197..2327613 (-) | 417 | WP_021214451.1 | phage tail assembly chaperone | - |
| LLUC77_RS12020 (LLUC77_03525) | - | 2327758..2328351 (-) | 594 | WP_010905928.1 | phage tail protein | - |
| LLUC77_RS12025 (LLUC77_03530) | - | 2328382..2328777 (-) | 396 | WP_063280625.1 | DUF806 family protein | - |
| LLUC77_RS12030 (LLUC77_03535) | - | 2328774..2329280 (-) | 507 | WP_081172179.1 | HK97 gp10 family phage protein | - |
| LLUC77_RS12035 (LLUC77_03540) | - | 2329282..2329632 (-) | 351 | WP_002819792.1 | phage head closure protein | - |
| LLUC77_RS12040 (LLUC77_03545) | - | 2329607..2329930 (-) | 324 | WP_010905932.1 | head-tail connector protein | - |
| LLUC77_RS12045 (LLUC77_03550) | - | 2329946..2331172 (-) | 1227 | WP_010905933.1 | phage major capsid protein | - |
| LLUC77_RS12050 (LLUC77_03555) | - | 2331184..2331888 (-) | 705 | WP_002819795.1 | head maturation protease, ClpP-related | - |
| LLUC77_RS12055 (LLUC77_03560) | - | 2331934..2333112 (-) | 1179 | WP_010905935.1 | phage portal protein | - |
| LLUC77_RS12060 (LLUC77_03565) | - | 2333109..2333318 (-) | 210 | WP_010905936.1 | DUF1056 family protein | - |
| LLUC77_RS12065 (LLUC77_03570) | - | 2333287..2335257 (-) | 1971 | WP_161940569.1 | terminase large subunit | - |
| LLUC77_RS12070 (LLUC77_03575) | - | 2335247..2335720 (-) | 474 | WP_010905938.1 | phage terminase small subunit P27 family | - |
| LLUC77_RS12075 (LLUC77_03580) | - | 2335849..2336364 (-) | 516 | WP_010905939.1 | HNH endonuclease | - |
| LLUC77_RS12080 (LLUC77_03585) | - | 2336366..2336701 (-) | 336 | WP_237025227.1 | hypothetical protein | - |
| LLUC77_RS12085 (LLUC77_03590) | - | 2336851..2337252 (-) | 402 | WP_011835815.1 | DUF722 domain-containing protein | - |
| LLUC77_RS12090 (LLUC77_03595) | - | 2337332..2337493 (-) | 162 | WP_004254238.1 | hypothetical protein | - |
| LLUC77_RS12095 (LLUC77_03600) | - | 2337618..2337959 (-) | 342 | WP_081172183.1 | hypothetical protein | - |
| LLUC77_RS12100 (LLUC77_03605) | - | 2337968..2338150 (-) | 183 | WP_081172185.1 | DUF1660 domain-containing protein | - |
| LLUC77_RS12105 (LLUC77_03610) | - | 2338147..2338386 (-) | 240 | WP_081172187.1 | hypothetical protein | - |
| LLUC77_RS12110 (LLUC77_03615) | - | 2338405..2338731 (-) | 327 | WP_082231506.1 | hypothetical protein | - |
| LLUC77_RS12115 (LLUC77_2100) | - | 2338797..2339489 (-) | 693 | WP_081172191.1 | hypothetical protein | - |
| LLUC77_RS12120 (LLUC77_2101) | - | 2339476..2339838 (-) | 363 | WP_081172193.1 | hypothetical protein | - |
| LLUC77_RS12125 (LLUC77_2102) | - | 2339831..2339992 (-) | 162 | WP_014570542.1 | hypothetical protein | - |
| LLUC77_RS12130 (LLUC77_2103) | - | 2340015..2340266 (-) | 252 | WP_081172195.1 | hypothetical protein | - |
| LLUC77_RS12135 (LLUC77_2104) | - | 2340263..2340616 (-) | 354 | WP_203415685.1 | hypothetical protein | - |
| LLUC77_RS12140 (LLUC77_2105) | - | 2340621..2341040 (-) | 420 | WP_081172197.1 | dUTP diphosphatase | - |
| LLUC77_RS12145 (LLUC77_2106) | - | 2341037..2341699 (-) | 663 | WP_301672591.1 | DUF1642 domain-containing protein | - |
| LLUC77_RS12150 (LLUC77_2107) | - | 2341723..2342055 (-) | 333 | WP_081172201.1 | hypothetical protein | - |
| LLUC77_RS12155 (LLUC77_2109) | - | 2342378..2342788 (-) | 411 | WP_081172203.1 | hypothetical protein | - |
| LLUC77_RS12160 (LLUC77_2110) | - | 2342801..2343043 (-) | 243 | WP_014570811.1 | L-rhamnose isomerase | - |
| LLUC77_RS12165 (LLUC77_2111) | - | 2343036..2343968 (-) | 933 | WP_081172205.1 | phage replisome organizer N-terminal domain-containing protein | - |
| LLUC77_RS12170 (LLUC77_2112) | - | 2344232..2345158 (-) | 927 | WP_081172207.1 | RecT family recombinase | - |
| LLUC77_RS12175 (LLUC77_2113) | - | 2345155..2345988 (-) | 834 | WP_081172209.1 | hypothetical protein | - |
| LLUC77_RS12180 (LLUC77_2114) | - | 2346090..2346332 (-) | 243 | WP_081172211.1 | hypothetical protein | - |
| LLUC77_RS12185 (LLUC77_2115) | - | 2346345..2346467 (-) | 123 | WP_023164646.1 | hypothetical protein | - |
| LLUC77_RS12190 (LLUC77_2116) | - | 2346464..2346646 (-) | 183 | WP_003130605.1 | hypothetical protein | - |
| LLUC77_RS12195 (LLUC77_2117) | - | 2346662..2347351 (-) | 690 | WP_081172213.1 | Rha family transcriptional regulator | - |
| LLUC77_RS12200 (LLUC77_2118) | - | 2347410..2347643 (-) | 234 | WP_014570819.1 | helix-turn-helix transcriptional regulator | - |
| LLUC77_RS12205 (LLUC77_2119) | - | 2347850..2348227 (+) | 378 | WP_032944420.1 | helix-turn-helix domain-containing protein | - |
| LLUC77_RS12210 (LLUC77_2120) | - | 2348238..2348822 (+) | 585 | WP_023349179.1 | hypothetical protein | - |
| LLUC77_RS12215 (LLUC77_2121) | - | 2348878..2349417 (+) | 540 | WP_023189015.1 | PH domain-containing protein | - |
| LLUC77_RS12220 (LLUC77_2122) | - | 2349543..2351000 (+) | 1458 | WP_081172268.1 | recombinase family protein | - |
| LLUC77_RS12225 (LLUC77_45555) | - | 2350997..2351137 (-) | 141 | WP_023164653.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 94 a.a. Molecular weight: 10783.02 Da Isoelectric Point: 5.0604
>NTDB_id=183287 LLUC77_RS11940 WP_010906314.1 2307013..2307297(-) (comGG) [Lactococcus lactis subsp. lactis strain UC77]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGANFQIKN
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGANFQIKN
Nucleotide
Download Length: 285 bp
>NTDB_id=183287 LLUC77_RS11940 WP_010906314.1 2307013..2307297(-) (comGG) [Lactococcus lactis subsp. lactis strain UC77]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGG | Lactococcus lactis subsp. cremoris KW2 |
59.14 |
98.936 |
0.585 |