Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGD   Type   Machinery gene
Locus tag   LLUC08_RS10810 Genome accession   NZ_CP015903
Coordinates   2193234..2193515 (-) Length   93 a.a.
NCBI ID   WP_237025754.1    Uniprot ID   A0AAC9R736
Organism   Lactococcus lactis subsp. lactis strain UC08     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2188234..2198515
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLUC08_RS10775 (LLUC08_2089) - 2189042..2189851 (-) 810 WP_014570791.1 metal ABC transporter permease -
  LLUC08_RS10780 (LLUC08_2090) - 2189844..2190581 (-) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  LLUC08_RS10785 (LLUC08_2091) - 2190758..2191600 (-) 843 WP_015427160.1 metal ABC transporter substrate-binding protein -
  LLUC08_RS10790 (LLUC08_2092) - 2191597..2192034 (-) 438 WP_003129992.1 zinc-dependent MarR family transcriptional regulator -
  LLUC08_RS10795 (LLUC08_2093) comGG 2192116..2192400 (-) 285 WP_025017139.1 competence type IV pilus minor pilin ComGG Machinery gene
  LLUC08_RS10800 (LLUC08_2094) comGF 2192439..2192885 (-) 447 WP_029344525.1 competence type IV pilus minor pilin ComGF Machinery gene
  LLUC08_RS10805 (LLUC08_2095) comGE 2192848..2193144 (-) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  LLUC08_RS10810 (LLUC08_2096) comGD 2193234..2193515 (-) 282 WP_237025754.1 prepilin-type N-terminal cleavage/methylation domain-containing protein Machinery gene
  LLUC08_RS10815 (LLUC08_2097) comGC 2193508..2193891 (-) 384 WP_081040674.1 competence type IV pilus major pilin ComGC Machinery gene
  LLUC08_RS10820 (LLUC08_2098) comGB 2193905..2194978 (-) 1074 WP_081041295.1 competence type IV pilus assembly protein ComGB Machinery gene
  LLUC08_RS10825 (LLUC08_2099) comGA 2194872..2195810 (-) 939 WP_031561106.1 competence type IV pilus ATPase ComGA Machinery gene

Sequence

Protein


Download         Length: 93 a.a.        Molecular weight: 10696.57 Da        Isoelectric Point: 5.1067

>NTDB_id=183145 LLUC08_RS10810 WP_237025754.1 2193234..2193515(-) (comGD) [Lactococcus lactis subsp. lactis strain UC08]
MTRAFTLLESLLVLLIISFITTLFSSEIIQTVHLFKGELFVLQFENFYKRSQEEAALLQKSESLVAKNQELICEDRSITI
PKEVAVKDFTVKL

Nucleotide


Download         Length: 282 bp        

>NTDB_id=183145 LLUC08_RS10810 WP_237025754.1 2193234..2193515(-) (comGD) [Lactococcus lactis subsp. lactis strain UC08]
ATGACTAGAGCATTTACTTTACTAGAGTCTCTTCTAGTTTTGTTGATTATTTCTTTTATCACAACTCTTTTTTCTTCAGA
AATAATACAAACAGTCCATCTTTTTAAGGGAGAATTGTTTGTTCTTCAATTTGAAAATTTCTATAAAAGGAGTCAAGAAG
AGGCTGCACTGCTTCAAAAATCTGAAAGTTTAGTTGCTAAAAATCAAGAATTAATCTGTGAAGATAGAAGTATCACAATT
CCAAAGGAGGTAGCAGTTAAAGATTTTACAGTTAAATTATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Lactococcus lactis subsp. cremoris KW2

67.391

98.925

0.667

Multiple sequence alignment